KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325502
Entry
4325502           CDS       T01015                                 
Name
(RefSeq) DExH-box ATP-dependent RNA helicase DExH6
  KO
K14442  ATP-dependent RNA helicase DHX36 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4325502
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4325502
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4325502
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     4325502
SSDB
Motif
Pfam: HA2 Helicase_C R3H OB_NTP_bind DEAD AAA_22 ATPase AAA_19 Ank_5 AAA_23 Ank_2 Rad17 ABC_tran AAA_7 PhoH T2SSE AAA_25
Other DBs
NCBI-GeneID: 4325502
NCBI-ProteinID: XP_015611956
LinkDB
Position
1:32350346..32360562
AA seq 1305 aa
MAHTSGVAARLNLVFMGRPLARSAQPPPSGPRFSGRAQRRRGSNEATACGKGRSRAGRAA
SPDVVATKPPPLHDEEEEEGGRMVRRGRKGKDAAAGAGGTGGRGGGAGRGGGRGGSGGGG
GGGGVREATLVRVSKVLEDFQASDAQVYKFEPGISKQERAAIHEMCRKMGMISKSSGNGE
RRCLSVYKRKQNQGLETEEGPSHLGFSVEARNVLQDLFMHYPPDDAELNGHTVRNSSDKA
VKIQWKPDGAFCRPALRKPDILKKVEMLASKVNKSEQLRKIVQDRSKLPISSYKDAISST
LENHQVVLISGETGCGKTTQVPQYILDHMWGKGESCKIVCTQPRRISAISVAERISAERG
ESVGDTVGYKIRLESKGGKNSSIMFCTNGVLLRLLIGRVTNISKEQNQKRSFDDAVTGIT
HIIVDEIHERDRFSDFMLAILRDLLPLYPHLRLVLMSATIDAERFSNYFSGCPFIQVPGF
THPVKTFYLEDVLSILQSVGDNHLDPTTDDLKQSSLLTDDYKSSMDEAINLALDNDEFDP
LLELISAEQNQEIFNYQHSETGVTPLMVLAGKGQVGDICMLLSFGVDCSTRDHDGKSALG
WAEQGNQQEVCEVIKKHMECGSAKLTEENELLNKYLATINPEHIDTVLIERLLRKICVDS
NEGAILVFLPGWEDINQTRERLLASPFFQDSSKFLVLSLHSMIPSSEQKKVFKRPPAGSR
KIILSTNIAETAVTIDDVVFVIDSGRMKEKSYDPYNNVSTLHSSWVSKANARQRQGRAGR
CQPGTCYHLYSRFRAASLLEYQIPEIKRMPIEELCLQVKLLDPNCRIADFLRKTLDPPIP
ETVRNAITVLQDLGALTQDEQLTELGEKLGSLPVHPSTSKMLLFGILMNCLDPALTLACA
ADYRDPFLLPMAPDERKRAAAAKVELASLYGGYSDQLAVVAAMDCWRRAKDRGQEAQFCS
KYFVSSNTMNMLSNMRKQLQNELAQRGFVPVDASACSLNARDPGIIRAVLMAGAYPMVGR
LLPPRKNTRRAVIETASGAKVRLHPHSCNFNLSFRKTSGNPLVIYDEITRGDGGMYIKNS
SVVGSYPLIILATEMVVAPPEDDDSDEEDGDSSEDETEKVTLGQHKEIMSSPDNSVSVVI
DRWLRFDATALDVAQIYCLRERLASAILFKVKHPQDVLPPDLGATMYAIACILSYDGLPA
MITSDDVATSQGSNQSSAESSRFSQGRRVGYIPPGGFLMSLLSDKPLNAPHFQKSFNHPD
GASGHIRSSRTSVGRFDQSRHPQRNNSGPGSSAARTFKRQRNGAQ
NT seq 3918 nt   +upstreamnt  +downstreamnt
atggcccacacgtcaggcgtggccgcccgtctgaacctggttttcatgggccgcccgctc
gcacgcagcgcgcagccaccgccatctgggcctaggttttccgggagagcgcagcggcgg
cgcggaagcaacgaagcgaccgcttgcgggaagggccggagccgagccggccgcgccgcc
tcgcccgacgtcgtagcaaccaagccacccccgctccacgacgaggaggaggaggaggga
ggaaggatggtgaggagagggcggaagggcaaggacgcggcggctggcgccggcggcacc
ggtggcagaggcggcggtgccggcagaggaggcggcagaggaggaagcggcggcgggggc
gggggagggggtgttcgggaggcgacgctggtgcgcgtctcgaaagtgctcgaggacttc
caagcctccgacgcccaggtgtacaaatttgaacctggcatatcgaaacaagagcgagcg
gcgatacatgagatgtgtagaaaaatgggcatgatatccaaaagttctgggaatggggaa
cgacgatgcctatctgtttacaaaagaaaacagaaccagggccttgaaacagaagaagga
cctagccatcttggattttctgtggaagcgagaaatgttttgcaagatctatttatgcat
tatcccccagatgatgcggagctaaatgggcatactgtcaggaattctagtgataaggct
gtaaagattcagtggaagccagatggtgcattttgtaggccagcattgcgcaaaccggat
atattgaagaaggtggagatgcttgcatcgaaagtaaataaatccgaacagttgaggaag
attgtccaagatagatctaaacttccaatttcctcatacaaggatgcaatttcttcgact
ttagagaatcaccaggtggttcttatttctggagaaacaggatgtggtaaaacaacacag
gttcctcaatatatcttggatcatatgtggggtaagggtgaatcatgtaagattgtatgc
actcaaccaaggcgaatatcagctatctcagttgctgagagaatctctgcggaaagagga
gagtctgtgggtgacacagttgggtataagatacgcttggagtcaaaaggagggaagaac
tcatcaatcatgttctgcacaaatggtgttcttttgaggctattgataggcagggtaact
aatatttcaaaagaacaaaatcagaaacgctcatttgatgatgcagttactgggataaca
catattattgtggatgaaatccatgaaagggacaggttttcagatttcatgttggctatt
ctaagagatttgctgccgttgtatcctcatctgcgtttggtactcatgagtgcaacgatt
gatgctgagcggttctcaaattatttcagtggatgcccatttattcaagtcccagggttt
acccatcctgtcaaaactttctatttggaggatgtgctttctattttgcaatctgtaggc
gataatcatcttgatcctacaacagatgatctgaaacagagcagtttgttaacagatgat
tacaaaagctcaatggatgaagccattaacctagctttggataatgatgaatttgatcct
cttcttgagcttatttctgctgagcagaaccaagaaattttcaattaccagcactcagaa
actggtgtgacacctttgatggttcttgctggaaaaggtcaggttggggacatttgcatg
cttctatcatttggggtggattgttctacacgggatcatgatggaaaatctgcattaggt
tgggcagaacaagggaatcagcaagaggtttgcgaagttattaagaaacatatggaatgt
ggttcagcaaagttaactgaagagaatgagctgctcaataaatacttggcaaccatcaat
cctgagcacatcgatactgtgctaatagaacggttgctcagaaaaatttgtgttgattcc
aatgaaggagctatcttggtgtttcttcctgggtgggaagatataaatcaaacacgggaa
aggttgcttgcttctcccttctttcaggattcgtcaaagtttcttgtgttgtcactccat
tccatgatcccatcttcggagcagaaaaaagttttcaagcgtccaccagcaggatctcgt
aaaataattctctcaaccaacatagcagagactgctgtgacaattgatgacgtcgtattt
gtcatagatagtgggagaatgaaagagaaaagttatgatccatataataatgtctcaaca
cttcattcttcctgggtttcaaaagctaatgccagacaacgtcaagggcgtgcgggtcgt
tgtcagccaggaacgtgctaccatctctactctagatttcgagcagcctcattactggaa
taccaaatccctgaaataaagaggatgcctattgaggaactatgtttacaggtcaaactg
cttgatccgaactgcagaattgcagactttttaaggaaaactttggaccctccaattcca
gaaactgtaagaaatgctatcaccgtacttcaggatcttggtgctttgactcaagatgaa
caactgacagagttaggggaaaagttgggctcccttccggtccatccatctacaagcaag
atgctcttgtttggtatattaatgaattgcctagatccggcgttgacattggcatgtgca
gcagattatagagatcctttcctccttccaatggctccagatgagaggaaaagggctgct
gcagccaaagttgagcttgcttcattgtatggtggatacagtgatcagcttgcagttgta
gcagcaatggactgttggagacgtgccaaagataggggccaagaagctcaattttgttct
aagtattttgtgtcttctaacaccatgaatatgctttcaaacatgaggaaacagcttcag
aatgaactagcccaaagaggatttgttcctgtagatgcatctgcatgcagcttaaatgct
agagatccaggtatcattcgtgctgtccttatggccggtgcttatccaatggtagggaga
ttgcttccccctcgcaaaaatactagaagagcagtcattgaaacagcaagtggtgccaaa
gttcgactgcatccacattcttgcaactttaacttgtctttccgtaagacttctgggaac
ccattagtgatatatgatgagatcactcgaggcgatggtggaatgtacataaaaaactct
tcggttgttgggtcctatcctttaattattcttgctacggaaatggttgttgctccacct
gaggacgatgatagtgatgaagaggatggggattctagtgaggatgaaactgagaaagtc
actttgggacaacataaagagataatgtcttctcctgataactctgtttcagttgttatt
gatcgatggcttcggtttgatgctacagctcttgatgttgctcaaatatactgccttagg
gagcgcctagcatcagctattcttttcaaagtcaaacatccacaggatgtcctcccacct
gatcttggagcaactatgtatgctattgcgtgcatcctatcatacgatggcttgcctgct
atgattacatctgatgatgttgctacaagtcagggttcaaaccaaagttcagctgaatca
agcagattctctcagggtcgtagagtcggttatattccacctggcggtttcctcatgtct
ttgttatcggataaacctcttaatgcgcctcattttcagaagtcctttaatcatccagat
ggagcttcagggcatattcggtcatcgaggacctccgtcggtagatttgatcagtctcgc
catcctcaacgtaataattctggacctgggagttcagcagcacggactttcaaaagacag
cgcaacggtgcacagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326075
Entry
4326075           CDS       T01015                                 
Name
(RefSeq) DExH-box ATP-dependent RNA helicase DExH3
  KO
K14442  ATP-dependent RNA helicase DHX36 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4326075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4326075
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4326075
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     4326075
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD dsrm T2SSE AAA_30 AAA_22 AAA_19 NACHT PhoH ATPase AAA_16
Other DBs
NCBI-GeneID: 4326075
NCBI-ProteinID: XP_015643188
LinkDB
Position
1:1019912..1030114
AA seq 1247 aa
MLLASCLRGRLRLHRRPRPLIMPSPLFLSRNPNPSPPRSATATGTTILSPPSTSASASMS
TSGVYVPPMRRLRSVIASTNGSLAPPPSAAAQAQPVRAPEWRADGRSLSPPPSPPRPPRR
ATPPPPRQPPPQPEPFRQRSAGYARYAYDDFSEDDSDREMDRTSVSSRGGSTLDNIDEWK
WKLHMLLRNEDEQEVISRERKDRRDFEQLSQLAERMGLYSRQYSRIVVFSKVPLPNYRSD
LDDKRPQREVSIPSGLQREVDALLSDYLARKRTSSGSFPNAAFSRSSSTDSFATDESFLE
QQDNQTSTSAVIERIQRRKSLQLRNQQESWQESHDGQSMMEFRRSLPAYKERQTLLEAIA
QNQVVVVSGETGCGKTTQLPQYILESEIDAARGATCSIICTQPRRISAIAVSERVAAERG
EKIGESVGYKVRLEGMKGRDTRLLFCTTGVLLRRLLVDRNLKGVTHVIVDEIHERGMNED
FLLIVLKDLLPRRPELRLVLMSATLNAELFSSYFGGAPMIHIPGFTYPVRSRFLEDILEI
TGHRLTPYNQIDDYGQEKSWKMQKQALRKRKSQIASVVEDTVQAADLRDYSARTRDSLSC
WNPDSIGFNLIENVLCHICQKERAGAVLVFMTGWDDINALKEQLQANPLLGDPSKVLLLA
CHGSMASSEQKLIFDRPEPGVRKIVLATNLAETSITINDVVFVVDCGKAKETSYDALNNT
PCLLPTWISKASARQRRGRAGRVQPGECYHLYPQCVYEAFADYQLPELLRTPLQSLCLQI
KSLRLGSISEFLSRALQSPESLSVENAIEYLKVIGAFDRNEELTILGKHLSMLPVEPKLG
KMLIFGAIFNCLDPILTIVSGLSVRDPFLTPFDKKDLAESAKLQFSCRDYSDHLALVRAY
EGWREAERDRNGYDYCWKNFLSVQTLKAIDSLRRQFLFLLRDTGLVDENMTACNKWSRDE
NLVRAVICAGLYPGVSSVVNKEKSISLKTMEDGQVMLYSSSVNGKETKIPFPWLVFNEKV
KVNSVFLRDSTAISDSILLLFGGNIKQGGLDGHLKMLGGYLEFFMSRDLASTYLSLKSEL
DNLIHCKLQNPRMDIQTSEELLSAIRLLVTEDPCNGRFVYGRQEQRSKKAKTMFSAAPMS
HGGGGNGGDNAKNQLQTLLTRAGHDNPSYKTKQIKNSLFRSTVEFNGMQFVGQPCANKKL
AEKDAAGEALNWLTGGAPSDSRDPQDMDHMSMLQKPPRRKRHHHRRG
NT seq 3744 nt   +upstreamnt  +downstreamnt
atgctcctggcctcctgcctccggggtcgcctccgcctccaccgccggcctcgcccgctg
atcatgccctccccgctcttcctctcccggaaccctaatccttctcccccacgcagcgcc
actgccactggcaccaccatcctctccccgccctccacctccgcctccgcctccatgagc
acgagcggggtctacgtcccgccgatgcggcgcctccgctccgtcatcgcgtccaccaac
ggcagcctcgctccgccgccgtccgcggccgcgcaggctcagccggtgcgcgcgcccgag
tggcgggcggacgggcgctcgctcagccccccgccgtccccgcctcgaccgccccggcgc
gcgacgcctccccctccacggcagcctcctcctcagccagagcctttccggcagcggagc
gccgggtacgcccggtacgcctacgacgatttctctgaggatgactcggatcgggagatg
gaccgcacctccgtctcgagtaggggtggatccactttagataatattgatgaatggaaa
tggaaactgcacatgcttcttcgtaacgaagatgagcaagaggttatctctagggaaaga
aaggacagacgtgattttgaacaactttcccaactggccgaacgaatgggtttgtacagc
cgtcagtattctaggattgttgtgtttagtaaggttccattgcctaattatagatcagac
cttgatgacaaaagaccacaaagagaggtgtctattccttctggattgcaaagagaagtt
gatgctttgctttcagattatcttgcacggaagagaacaagcagtgggagctttcctaat
gccgctttctcaaggtcaagtagcacagacagttttgcaactgacgaaagcttcttggag
cagcaagataatcagacttcaaccagtgctgtgatagagagaatacaaagaagaaaaagc
ctacagttgcgtaatcaacaggaatcatggcaggaatcacatgatggccaaagcatgatg
gaatttcgtcgcagtcttcctgcttataaagaaaggcaaacattattggaagctatagct
cagaatcaggttgttgtagtttcaggtgaaacaggatgtggtaagacaacacagctacct
cagtacattttagagtctgaaatagatgctgctcgtggtgccacttgcagtattatttgt
actcaaccaagacgaatatcagccatagctgtttctgaaagagttgctgctgaaagaggg
gaaaaaattggtgaatcggttggctacaaagttcggttggaaggaatgaaaggacgggac
acacgccttcttttctgtactactggagttctgttgcggagattgctggtggatagaaat
ttgaaaggtgttacccatgttattgttgatgaaatccatgagcgtggcatgaatgaagat
tttcttcttattgtcctgaaggaccttcttccacgccggcctgagctaagacttgttttg
atgagtgcaacccttaacgctgagttattctcttcatactttggtggagctcccatgata
catatacctggtttcacttatcctgttcggagtcgatttctagaagatattctcgaaatt
actgggcacagattaactccttacaatcaaattgatgactatggtcaagagaaaagttgg
aagatgcaaaagcaagctctaaggaagaggaagagccaaattgcttcggttgtagaagat
acagttcaagctgctgatttaagggactacagtgcacgaactcgtgactcactatcctgt
tggaatcctgattcgattggttttaacttgatagaaaatgtcttatgccatatatgccaa
aaggaaagagctggcgcagttcttgtatttatgactgggtgggatgacatcaatgcactg
aaagagcagctgcaagcaaacccattgcttggagaccctagtaaagttttactgcttgca
tgtcatggttcaatggctagctcagagcagaaactaatatttgatagacctgagcctggt
gtaaggaaaattgttcttgcaaccaatttggctgaaacaagtattactatcaatgatgta
gtttttgtggttgattgtggcaaagcaaaagagacatcttatgatgcattgaacaacact
ccatgtttgcttccaacctggatctccaaggcttctgccagacagagacgaggaagagct
ggtcgagtccaaccaggggagtgttaccatctatatccacaatgcgtgtatgaagcattt
gctgactatcagttgccagaactcctgagaactcctctgcaatccctctgtttgcaaata
aaaagcttgcgccttgggagcatctctgaatttttatccagagctttgcaatcacctgag
tctctatcggtagaaaatgccattgaatatctcaaagtcattggagcgtttgatcgtaat
gaagagttaacaattctaggaaagcacttatccatgcttccagttgagcctaaattgggg
aagatgctgatttttggtgctatttttaattgccttgatcccatattaaccattgtttcg
ggacttagtgtgagagatccattcttgactccatttgacaagaaggatcttgcagagtct
gctaaattgcagttttcatgccgggactatagcgatcaccttgcacttgttcgtgcatac
gaaggatggagagaggctgaaagagatcgcaatggctatgactactgctggaaaaatttt
ctatccgtgcaaaccttgaaagccatagattcccttcggagacaatttctctttcttctc
agggatactgggttggttgatgaaaacatgactgcgtgcaataaatggagccgtgatgaa
aatctagttcgggcggtcatttgtgcaggattatatccaggtgtttcctctgttgtgaac
aaggagaaatcaatttctctcaagacaatggaggatgggcaagtcatgctttactcgagt
tcagtcaatggaaaagaaaccaagattcccttcccctggctggtgttcaatgagaaggtg
aaggtgaattctgtttttctccgggactcaacggctatatctgattctatactgttactc
tttggaggcaacataaaacaagggggcttggatggacatttgaaaatgcttggaggatat
cttgagttcttcatgagtcgtgatcttgcatcaacttacttgagtctcaagagtgaactt
gataatttaatccattgcaagctccaaaacccgaggatggacatccaaaccagtgaagag
cttctgtcagcgattagactgcttgtcactgaggatccatgcaacggtcgtttcgtatat
ggtcgacaagagcaaagatcaaagaaagcaaagacaatgttctctgcagcccccatgagc
catggtggtggtggaaatggaggagacaatgctaagaaccagctccagacccttctcact
agggctgggcatgataacccatcctacaagacgaagcaaatcaagaacagcctcttcagg
tcgaccgtggagttcaatgggatgcagtttgtagggcagccgtgtgccaacaagaagctt
gcggagaaggatgctgcaggagaggcactgaactggctgacaggaggagctccctccgac
tcaagagatccccaagacatggatcacatgtccatgcttcagaaaccaccacgcaggaag
aggcatcatcataggaggggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334111
Entry
4334111           CDS       T01015                                 
Name
(RefSeq) DExH-box ATP-dependent RNA helicase DExH3
  KO
K14442  ATP-dependent RNA helicase DHX36 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4334111
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4334111
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4334111
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     4334111
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C dsrm DEAD AAA_22 ATPase T2SSE AAA_19 ABC_tran NACHT PhoH AAA_23 Myosin_head
Other DBs
NCBI-GeneID: 4334111
NCBI-ProteinID: XP_015630592
UniProt: A0A0P0W309
LinkDB
Position
3:complement(30815620..30822586)
AA seq 1150 aa
MRGGLRRGLGILLLPLSSSPSRAPRPPVPLAALLVYHRRLDVFARRSFCSSGGGYAVEQF
SDDEYDHEYEDHRPSSSVANIDEWRWKLSMLQRNAEEQEIISRDRRDRRDYDQIANLAKR
MGLYSEMYGKVIVASKVPLPNYRPDLDDKRPQREVVIPLSLQRRVEGLVQEHLDRALLPD
KCGTGNGSEMAEKAENVNLDEQQDSLLDRSVMEKILQRKSIRMRNFQRSWQESPEGVKML
EFRKSLPAYKEKERLLAAIARNQVIVISGETGCGKTTQLPQFVLESEIESGRGAFCNIIC
TQPRRISAMAVAERVSTERGENLGESVGYKVRLEGIKGKDTHLLFCTSGILLRRLLSDRN
LNGVTHVFVDEIHERGMNEDFLLIVLKDLLSRRRDLRLILMSATLNAELFSSYFGGAPTI
HIPGFTYPVRAHFLEDILERTGYKLTSSNQLDDYGQDKVWKTQRQLLPRKRKNQITTLVE
DALKTSSFETYGSRTRDSLSNWNPDCIGFNLIEAVLCHICRKERSGAVLVFMTGWDDISC
LKDQLKAHPLLGDPNRVLLLACHGSMATAEQRLIFEKPPPNVRKIVLATNMAEASITIND
IVFVVDCGKAKETTYDALNNTPCLLPSWISKASARQRRGRAGRVQPGECYHLYPRCVYDA
FADYQLPELLRTPLNSLCLQIKSLQVGSIGEFLSAALQPPAPLAVQNAVEFLKMIGALDE
NENLTDLGRYLSMLPVDPKLGKMLIMGAVFRCIDPILTVVAGLSARDPFLLPQDKRDLAG
TAKSRFSAKDYSDHMALVRAYEGWKDAEREGSAYEYCWRNFLSAQTLQAIHSLRKQFSYI
LKDAGLVDSDANTNNSLSHNQSLVRGIICSGLFPGITSVVHRENSMSFKTMDDGQVLLYA
NSVNAKYQTIPYPWLVFGEKVKVNAVFIRDSTGVSDSILILFGGAVTKGSMAGHLKMLDG
YIDLFMDPSLCECYLQLKEELDKLVQKKLEDPSFDIHKEGKYILYAAQELAAGDLCEGRF
VFGRETSRARLSSSDDTKGNIIKDGMNPKSLLQTLLMRAGHTPPKYKTKHLKTNEFRAIV
EFKGMQFAGKPKRNKQLAERDAAIEALGWLTQTSGTKLQDDGDDSPLDLTDNMLKLLSRP
RRRSRNNSRK
NT seq 3453 nt   +upstreamnt  +downstreamnt
atgcgcggcggcttgcgccgcgggctgggcatcctcctcctcccgctctccagctcgccc
agccgggcgccgcggccgccggtcccgctcgctgctctgctcgtctaccaccgccgcctc
gatgtcttcgcccgccggtccttctgcagctccggcgggggctacgccgtggagcagttc
tccgacgacgagtacgaccacgagtacgaggatcaccggccgtcgtcgtcggtggcgaac
atcgacgagtggaggtggaagctgagcatgctgcagcgcaacgcggaggagcaggagatc
atctccagagaccggagggatcgccgggactacgaccagatcgccaacctcgccaagagg
atgggcctctacagtgagatgtatgggaaggtcattgttgcgagcaaggtcccgctgccg
aattacaggccggacctggacgacaagcggccacaaagagaggtggtgattccattaagc
ttacagaggagggttgaaggacttgtgcaggagcaccttgatcgtgcactcttgccggat
aaatgtggaactggaaatggttctgagatggctgagaaagctgagaatgtgaacctggat
gagcagcaggattcccttctcgatcgatcggtcatggagaagatccttcagaggaagagc
atacggatgcgcaattttcagagaagttggcaggaatcacctgaaggagttaagatgcta
gaattccggaaatcacttcctgcatacaaggaaaaggaaaggcttctagcagccattgca
cgcaatcaggttatagtgatatctggagagacagggtgtggcaaaacaacccagttgcct
caatttgtattagagtcagagatagaatctggccgtggggccttttgtaatataatctgc
acacaacctcggagaatttctgcaatggcagttgcagagagagtatccactgagagagga
gagaatcttggtgaatcggttggctacaaagttcgattggagggaatcaaaggaaaagac
acacatttgcttttctgcacaagtggtatattactacgacgattgctcagtgacagaaac
ctgaatggagtaactcatgtatttgttgatgaaatacatgaaagaggcatgaatgaagat
ttcttattgattgtcctaaaagacctattatcacgacgccgtgatttgaggttgatcttg
atgagtgctactctaaatgcggaactgttctcaagttattttggaggagcaccaactatc
catattcctggattcacatatccagtgagggcacattttctggaagatatattagagagg
actggctataagttgacctcaagcaatcaacttgacgattatggacaagataaagtctgg
aaaactcagaggcaactattacctagaaaaaggaaaaatcaaatcacaacgcttgttgag
gatgcccttaaaacttctagctttgagacctatggatcgaggacacgcgattctctgtca
aattggaatcctgattgcatagggtttaaccttatagaagctgttctttgccacatatgt
cgtaaagagcggtctggtgcagttctagttttcatgaccggatgggatgatatcagttgc
ttgaaggatcaactaaaggcacaccctttgttgggcgaccctaacagagttttactgctt
gcatgccatggttccatggctacagctgaacagaggttaatctttgagaagccacctcct
aatgttcggaagatagtgcttgccactaacatggcagaagcaagtattacaataaatgat
attgtttttgtcgtggattgtggaaaggcaaaggaaacgacatacgatgcactaaataac
actccctgcttgcttccctcatggatttcaaaggcttctgctcgtcagaggaggggcaga
gctggtcgtgtgcaacctggagaatgctatcacctctaccctagatgtgtgtatgatgca
tttgcagattaccagcttcctgagctccttagaactccattgaattcactatgtttgcag
ataaaaagtttgcaagttggcagcattggggagtttctatcagctgccttacagcccccg
gcaccactagctgtccaaaatgcagtggaattcctgaaaatgattggagcattagatgaa
aatgagaacctaactgatctaggaagatacctttccatgcttcctgttgatccaaagttg
gggaagatgcttataatgggtgcagttttccgctgcattgatcctatacttaccgtggtt
gctggattgagtgcccgggatcctttcctgctgccacaggacaagagagatttggcagga
accgccaaatcaagattctcagcaaaagattatagtgatcatatggccctagtccgggct
tatgaaggatggaaggatgcagagagagaagggtctgcttatgaatactgctggagaaat
ttcctttctgctcaaacacttcaagccattcactctcttcggaagcaattcagctatata
ttaaaggatgctggtttggtagactctgatgcaaatacaaataatagtttgagccataat
caatcattggtccgtggtatcatatgttctggacttttcccaggcataacatcagttgtg
catagagaaaactctatgtcgttcaagaccatggatgatggccaagttcttctttatgct
aattcagtgaatgctaagtaccagaccatcccttatccatggctggtctttggtgagaag
gtgaaggtaaatgctgtcttcatccgtgactcaaccggagtatcagattccatcctgatc
ttatttggtggtgctgttacaaaaggaagcatggctgggcacctgaagatgctcgatggt
tacatcgatttgtttatggatcctagcctgtgtgaatgctacttgcaacttaaagaagag
cttgataaacttgtacagaagaagcttgaagaccccagcttcgacatccacaaggaagga
aagtacatcttatatgccgcacaagagctcgctgcaggcgacctatgcgaaggaaggttt
gtgtttggccgcgagacgagcagagcaaggctcagcagcagcgacgacaccaaaggcaac
attatcaaggacggaatgaaccccaagagcctgctccagaccctgctgatgagggccggc
cacacccctcccaagtacaagacaaagcacctcaagaccaacgagttcagggccatagtg
gagttcaaagggatgcagtttgccgggaaacccaagaggaacaagcagctcgccgagagg
gacgccgccattgaagcgctgggatggctgacacagacctcagggacaaagcttcaggat
gatggcgatgattcccctcttgacctgacggataacatgctgaagttgctcagtagaccg
aggcggcggtccagaaacaattccaggaaatga

DBGET integrated database retrieval system