KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325533
Entry
4325533           CDS       T01015                                 
Name
(RefSeq) dol-P-Man:Man(6)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
  KO
K03846  alpha-1,2-mannosyltransferase [EC:2.4.1.259 2.4.1.261]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa00513  Various types of N-glycan biosynthesis
osa01100  Metabolic pathways
Module
osa_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4325533
   00513 Various types of N-glycan biosynthesis
    4325533
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:osa01003]
    4325533
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.259  dolichyl-P-Man:Man6GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     4325533
    2.4.1.261  dolichyl-P-Man:Man8GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     4325533
Glycosyltransferases [BR:osa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   4325533
SSDB
Motif
Pfam: Glyco_transf_22 zf-TRAF_2
Other DBs
NCBI-GeneID: 4325533
NCBI-ProteinID: XP_015622056
UniProt: Q5QNA3 A0A0P0UZP0
LinkDB
Position
1:5911506..5916816
AA seq 572 aa
MSLSSARQRRATAASPPTDDGYSKEAKDRRRRPSGEEEEEGIRWFLPFLALGLLRHMSAS
SNLIHDCDEVFNYWEPLHFLLYRSGFQTWEYSSNFALRSYLYLFIHALVAGPASMIFGEH
KVRVFYSVRIFLGLISTITETVLVVALSRKYGKRLACYVLAMLCLTSGCFFASTSFLPSS
FSMYAVTLSSALFLLENYAAAVSVAAAGVILGWPFSILVFLPITVYSLIRGSFRRVFLSG
FLTSMFLLVLSVIADYYCYGKWTASVFNLLKYNVFGGGESHLYGTEGPSFYFKNGFNNFN
FAFILALLFLGFVPFARKKYVPDLLIVVSPVYIWLAFMSLQAHKEERFLYPIYPLICVAA
AAVIDTFPDFFHDKYSSEQSIFEKIAKGLRPLILGFILCASHSRTFSMLNGYGAPIQIYQ
HLEHHEDTGPGSVLCVGSEWHRYPSSFFIPSYISEVWWIDDGFRGLLPFPFNETLGGTTA
APSYFNDKNKASDEQYLKDIGACSLLVELDLRRPYPSRGSDLSTWETLAALPFLDRELSP
ALYRSFFIPHRWQQNNVFGLYKLLRRLPTDQA
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgtcgctctcgtcggcgcgtcagcgtcgggccacggccgcgtcgccgccgaccgacgac
ggctactccaaggaagccaaggacaggaggcggcgccccagcggcgaggaggaggaggag
ggcatccggtggttcctcccgttcctcgccctcggcctcctccgccacatgagcgcgtcc
tccaacctgatccacgactgcgacgaggtgttcaactactgggagcccctccacttcctc
ctctaccgctccggcttccagacctgggagtacagttccaactttgctcttagatcatat
ctgtaccttttcattcacgctcttgtagctgggcctgcttcaatgatttttggggagcat
aaggttcgagtgttctactctgtgagaatctttcttggccttatatcaactataacagaa
actgttctggttgttgctctttcaagaaaatatggaaaaagacttgcttgttatgtcctt
gcaatgctgtgcttaaccagtggctgcttctttgccagtaccagtttcttgccaagttca
ttctccatgtatgctgtaacactttcctctgcactcttcctacttgagaactatgctgct
gcagtctctgttgcagctgcaggagttatccttggttggcctttctcaattttggtgttt
ctccctattacggtttactcactaattagaggatctttcagaagagtatttttatctgga
tttctgacttccatgttccttcttgtcctttcggttattgctgattactactgctatggc
aaatggacagcatcagtgttcaatcttctgaaatataatgtgtttggtggtggtgaaagt
cacttgtatggaacagaggggccttcattctattttaagaatggattcaataacttcaat
tttgcgttcatcttggctctgctatttttggggtttgtgccatttgcaaggaagaaatat
gtcccagatctattgatagttgtatctcctgtctacatttggttggctttcatgtccttg
caggcacacaaagaagaaaggtttctttatccaatttacccattgatatgtgttgcagct
gcagctgttattgacacctttccagattttttccatgacaaatattcatctgaacagtct
atctttgaaaagatagcaaagggcctgcggcctttgatccttggcttcattttgtgtgct
tcccacagccgaacattctccatgttgaatggatatggtgcccctattcagatctaccag
catctggaacatcatgaagatactgggcctggttctgttctctgtgttgggagtgaatgg
caccgctatccatcatcgttcttcataccctcctatattagtgaagtttggtggatagat
gatggcttccgagggcttcttccatttcccttcaatgaaaccctgggaggcaccactgct
gctccatcttatttcaatgacaagaacaaggcctctgatgaacaatatctgaaagacatt
ggggcatgtagcttactggtggaacttgatcttagacggccttacccatcccgaggaagt
gatttgtcgacatgggagacactggctgcgctgccctttctggatagagagctttcacct
gcattataccggtcattcttcataccgcaccgatggcagcaaaacaatgtttttggcctg
tacaaactgctgaggaggctgcctactgaccaagcgtaa

DBGET integrated database retrieval system