KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325562
Entry
4325562           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 710A1
  KO
K09832  sterol 22-desaturase [EC:1.14.19.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4325562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4325562
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.41  sterol 22-desaturase
     4325562
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP710 family
   4325562
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4325562
NCBI-ProteinID: XP_015625810
UniProt: A0A8J8YGB3 Q9LE72
LinkDB
Position
1:complement(6030715..6033604)
AA seq 511 aa
MRTSTDPSGSIESFHGLVHLRTAAPLLAAAVALYMLIEQLSYHRKKGSMPGAPLVVPFLG
SAAHLIRDPVGFWDVQAALARKSGAGLAADFLFGRFTVFIRDSELSHRVFANVRADAFHV
VSHPFGKKLFGEHNLVYLVGEEHKDLRRRIAPNFTPRALSTYAVIQQRVIISHLRRWLDR
SASNGGKAEPIRVPCRDMNLETSQTVFVGPYLTEKARERFDRDYNLFNVGFITLPVDLPG
FAFRRARLAGARLMHTLGDCARQSRQRMLGGGEPECLLDYLMQETVREIDEATAAGLPPP
PHTSDVEVGALLFGFLFAAQDASTSSLCWAVSALDSHPNVLARVRAEVAALWSPESGEPI
TAEMMSAMKYTQAVAREVVRYHPPATLVPHIAVEAFQLTAQYTIPKGTMVFPSVYESSFQ
GFQDADAFDPDRFFSEARREDVVYKRNFLAFGAGPHQCVGQRYALNHLVIFMALFVSLVD
FRRERTEGCDVPVYMPTMVPRDGCVVYLKQR
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgagaaccagcactgacccgtccggctcaatcgagtcgtttcacggcctcgtacacctc
cgcacggcggcgccattgctggctgcagctgtggcgttatacatgctcatagagcagctg
tcataccaccgcaagaaggggtccatgccaggggcgccgctcgtcgtgccgttcctcggt
agcgccgcgcatttgatccgcgacccggtcggattctgggacgtgcaagcggcgctcgct
cgcaagtccggcgctgggctcgccgcggactttctcttcggccggttcacggtcttcatc
cgtgactcggagctgtcccaccgcgtgttcgccaacgtccgcgccgacgccttccacgtc
gtcagccacccgttcggcaagaagctcttcggcgaacacaacctcgtctacctggtcggc
gaggagcacaaggacctgcgccgccggatcgcgcccaacttcacgccgcgcgcgctctcc
acttatgccgtcatccagcagcgtgtcatcatctcccacctccggcggtggctcgaccgg
agtgcttccaacggcggcaaggccgagccgatacgggtgccctgccgcgacatgaacctg
gagacctcgcagacggtgttcgtggggccgtacctcaccgagaaggcgagggagaggttc
gacagggattacaacctcttcaacgtcggtttcataaccttgcccgtggaccttccgggg
ttcgcgttccgccgggcgaggctagccggggcacggctgatgcacactctcggggactgc
gcacgtcagagcaggcaacgcatgcttggcggcggcgagccagagtgcctcctggactac
ttgatgcaggaaacggtgcgtgagatcgacgaggccacggcagcggggctgccgccacca
ccgcacaccagcgacgtggaggtcggcgccctcctgttcggcttcctcttcgcggcgcag
gacgcgtccacctcctctctctgctgggcggtgtccgcgctcgactcccatccgaacgtg
ctcgcccgcgtccgtgctgaggtggccgctctctggtcgccagagtccggcgaacccatc
accgccgagatgatgtcggcgatgaaatacacccaggcggtggcgcgcgaggttgtccgg
taccatccaccggcgacgctggtgccgcacatcgccgtcgaggcgttccagctgacggcg
cagtacactatacccaagggcaccatggtgttcccatcggtgtacgagtcgtcgttccaa
gggttccaagacgctgacgcgttcgacccggaccgcttcttctcggaggcgcggagggag
gacgtggtgtacaagcgcaacttcctcgcgttcggcgccggcccgcaccagtgcgtcggt
cagcggtacgcgctcaaccacctcgtcatcttcatggcgctcttcgtctccctcgtcgac
ttccggcgtgagaggacggagggctgcgacgtgccggtgtacatgccgaccatggtgccg
agggacggctgcgtcgtctacctcaagcagcgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325563
Entry
4325563           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 710A1
  KO
K09832  sterol 22-desaturase [EC:1.14.19.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4325563
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4325563
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.41  sterol 22-desaturase
     4325563
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP710 family
   4325563
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4325563
NCBI-ProteinID: XP_015636842
UniProt: A0A0P0UZI6
LinkDB
Position
1:complement(6056995..6059139)
AA seq 504 aa
MVDSLLYGLLDLRMAAPLLAAAVALYVLVEQLSYHRKKGSLPGPPLVVPFIGSATHMIRD
PTGFWEMQAARARKSGVGFTADFLAGKFTIFIRDSELSNRVFANVRPDAFFVIGHPFGKK
LFGDHNLIYLFGDDHKDLRRRMATNFTPRALSTYAAIQQRGIVSHLRRWLDRSAANGGKA
EPIRVPCRDMNLETSQTVFAGPYLTEEARERFKSDYNLFNVGLLAFPVDLPGLAFRRARQ
AVARLVRMLRDCARESKARMRAGGEPECLVDYWMQETVREIDEAKAAGLPPPAHISDDEE
IGGFLFDFLFAAQDASTSSLCWAVSALDSHPDVLARVRAEVASLWSPDSGEPITADKIAE
MKYTKAVAREVVRHRPPATLMPHIALQNFQLTESYTIPKGTLVLPSMYESSFQGFHDPDA
FDPERFFSEARREDVVYKRNFLAFGAGPHQCVGQRYALNHLVIFMALFVSLVDFRRERTE
GCDVPVYMPTMVPRDGCVVYLKQR
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggtggactcgctgctatacgggctcctagacctgcgcatggcggcgccattgcttgca
gctgccgtggcgttgtacgtccttgtcgagcagctgtcctaccaccgcaagaaagggtcc
ctgccagggccgccgctcgtcgtgccgttcatcggcagcgccacgcacatgatccgcgac
ccgaccgggttctgggaaatgcaggctgctcgcgctagaaagtccggcgttgggttcacc
gccgacttcctggccggcaagttcacgatcttcatccgcgactcggagttgtccaaccgc
gtcttcgcgaacgtccgccccgacgccttcttcgtcatcggccacccgttcggcaagaag
ctcttcggcgaccacaacctcatctacctgttcggcgacgaccacaaggacctgcgccgc
cgtatggcgaccaacttcacgccgcgcgcgctctccacctacgccgccatccagcagcgc
ggcatcgtctcccacctccggcggtggctcgaccggagcgccgccaacggcggcaaggcc
gagccgatacgggtgccctgccgcgacatgaacctcgagacctcgcagacggtgttcgcg
gggccgtacctcaccgaggaggcgagggagaggttcaagagcgactacaatctcttcaat
gtaggcctcttggccttccccgttgacctgccggggctcgcgttccggcgtgcgaggcaa
gccgtggcgaggctggtgcgcatgctccgcgattgcgcgagggagagcaaggcgcggatg
cgcgccggcggtgagccagagtgcctcgtggactactggatgcaggagacggtgcgggag
atcgacgaggccaaggcggcggggctgccgccgccggcgcacatctccgacgacgaggag
atcgggggcttcctcttcgacttcctcttcgcggcgcaggacgcgtccacctcctccctc
tgctgggccgtgtccgcgctggactcccacccggacgtgctcgcccgcgtgcgcgccgag
gtggcctccctctggtcccccgactccggcgagcccatcaccgccgataagatcgccgaa
atgaagtacacaaaggctgttgctcgcgaggtggtccggcaccgcccaccggcgacgctg
atgccacacatcgccttgcagaacttccagctgacggaatcgtacacgatccctaagggc
accctggtgctcccgtcgatgtacgagtcgtcgtttcaggggttccatgaccccgacgcg
ttcgacccggagcgcttcttctcggaggcgcggagggaggacgtggtgtacaagcgcaac
ttcctcgcgttcggcgccggcccgcaccagtgcgtcggtcagcggtacgcgctcaaccac
ctcgtcatcttcatggcgctcttcgtctccctcgtcgacttccggcgtgagaggacggag
ggctgcgacgtgccggtgtacatgccgaccatggtgccgagggacggctgcgtcgtctac
ctcaagcagcgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325564
Entry
4325564           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 710A1
  KO
K09832  sterol 22-desaturase [EC:1.14.19.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    4325564
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4325564
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.41  sterol 22-desaturase
     4325564
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP710 family
   4325564
SSDB
Motif
Pfam: p450 PRP4
Other DBs
NCBI-GeneID: 4325564
NCBI-ProteinID: XP_015648135
UniProt: Q9LDQ4
LinkDB
Position
1:complement(6076730..6079085)
AA seq 508 aa
MAAVVDFLDLRAAAPFVVAALAFYFLVEQLSYHRKKGPLPGPPLVVPFVGSVAHMIRDPT
GFWDAQAARARKSGAGLAADFLIGRFVVFIRDSELSHRVFANVRPDAFHLIGHPFGKKLF
GDHNLIYMFGEDHKDLRRRIAPNFTPRALSTYAAIQQRVILSHLRRWLDRSAANGGKAEP
IRVPCRDMNLETSQTVFAGPYLTKEAREKFERDYNFFNVGLMALPVDLPGFAFRSARLGV
ARLVRTLGECARASKARMRAGGEPECLVDFWMQETVREIDEAKAAGKPPPAHTDDEELGG
FLFDFLFAAQDASTSSLCWAVSALDSHPDVLAGVRAEVASLWSPESGEPITAEKIAEMKY
TQAVAREVVRHRPPATLVPHIAGEEFQLTEWYTIPKGTIVFPSVYESSFQGFPEPDTFDP
ERFFSEARREDVVYKRNFLAFGAGPHQCVGQRYALNHLVLFMALFVSVVDFRRDRTEGCD
EPVYMPTIVPRDSCTVYLKQRCAKFPSF
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggcggcggtggtggacttcctggacctgcgggcggcggcgccgttcgtggtggccgcg
ctggcgttctacttcctggtcgagcagctgtcctaccaccgcaagaagggcccgctgcct
ggcccgccgctcgtcgtgccgttcgtcggcagcgtcgcgcatatgatccgcgacccgacc
gggttctgggacgcgcaggcggcgcgcgccaggaagtccggcgcggggctcgccgccgac
ttcctgatcggccggttcgtcgttttcatccgcgactccgagctgtcccaccgggtcttc
gccaacgttcgccccgacgcgttccacctcatcggccacccgttcggcaagaagctcttc
ggcgaccacaacctcatctacatgttcggcgaggaccacaaggacctccgccgccggatc
gcgcccaacttcacgccgcgcgcgctctccacctacgccgccatccagcagcgcgtcatc
ctctcccacctccggcggtggctcgaccggagcgccgccaacggcggcaaggccgagccg
attcgggtgccctgccgcgacatgaatctcgagacctcgcagacggtgttcgcggggccg
tacctcaccaaggaggcgagggagaagttcgagagggactacaatttcttcaatgtcggc
ctcatggccctccccgttgacctgccggggttcgcattccggagcgcgaggctgggcgtg
gcgcggctggtgcgcacgctcggcgagtgcgcgcgggcgagcaaggcgcggatgcgcgcc
ggcggcgaaccagagtgcctcgtcgacttctggatgcaggagacggtgcgggagatcgac
gaggccaaggcagcggggaagccgcctccggcgcacaccgacgacgaggagctcgggggc
ttcctgttcgacttcctcttcgcggcgcaggacgcgtccacctcctccctctgctgggcc
gtgtccgcgctggactcccacccggacgtgctcgcaggcgtgcgcgccgaggtggcctcc
ctctggtccccggagtccggcgagcccatcaccgccgagaagatcgcggagatgaagtac
actcaggccgtagctcgcgaggtggtccggcaccggccaccggcgacgctggtgccgcac
atcgccggcgaggagttccagctgacggagtggtacacgatccccaagggcaccatcgtg
ttcccgtcggtgtacgagtcgtcgttccaggggttccccgagccggacacgttcgacccg
gagcgcttcttctcggaggcacggagggaggacgtggtgtacaagcgcaacttcctcgcg
ttcggcgccgggccgcaccagtgcgtcgggcagcggtacgcgctcaaccacctcgtccta
ttcatggcgctcttcgtctccgtcgtggacttccggcgagaccggacggagggctgcgac
gagccggtgtacatgccgaccatcgtgccgagggacagctgcaccgtgtacctcaagcag
cgatgcgccaagttcccatctttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267882
Entry
9267882           CDS       T01015                                 
Name
(RefSeq) cytochrome P450 710A1
  KO
K09832  sterol 22-desaturase [EC:1.14.19.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00100  Steroid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    9267882
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    9267882
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.41  sterol 22-desaturase
     9267882
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP710 family
   9267882
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 9267882
NCBI-ProteinID: XP_015647013
UniProt: A0A0P0UZQ2
LinkDB
Position
1:complement(6037166..6039150)
AA seq 522 aa
MGTRTNPPGSMVESFHGLVVVDLRTAAPLLATAVALYILIEQLSYHRKKGSMPGPPLVVV
PFLGSVTHLFRDPVGFWDLQATRASKSGAGLTADFLFGRLMVFIRDSELSRRVFANVRAD
AFHLVGHPFGKKLFGDHNLIYMVGKEHKDLRRRIAPNFTPRALSTYAVIQQRVILSHLRR
WIDRSVANGGKAEPIRVPCRDMNLETSQTVFVGPYLTVETRERFDRDYNLFNHGFITLPI
DLPGSAFRRARLAVPRLKHILEDCARQSKQRMRGGGEPECLVDYLMQETVREIDEAAAAG
LPPPPHTSDMETGNLLFDFLFAAQDASTSSLCWAVSALDSHPDVLARVRAEVAALWSPES
GEPITAEMMTEMKYTQAVAREVVRYWPPGPVVPHIAGEAFQLTEQYTIPKGTIVFPSVYE
SSFQGFPDAGTFDPERFFSEARREDVVYKRNFLAFGAGPHQCVGQRYALNHLVIFMALLA
SLIDFRRERTEGCDVPVYMPTIVPRDGCVVHLKQRCAKLPSF
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgggaaccagaactaacccgcccggctcaatggtggagtcatttcacggcctggtcgtg
gtagacctccgcacggcggcgccattgctggctacagctgtggcgttgtacatcctcata
gagcagttgtcataccaccgcaagaaggggtccatgccagggccgccgctcgtcgtcgtg
ccattcctcggcagcgtcacgcacttgttccgcgacccggtcggattctgggacttgcaa
gcgacgcgtgctagcaagtccggcgctgggctcaccgcggactttctcttcggccggctt
atggtcttcatccgtgactcggagctgtcccgccgcgtgttcgccaacgtccgcgccgac
gccttccaccttgtcggacacccgttcggcaagaaactcttcggcgaccacaacctcatc
tacatggtcggaaaggagcacaaggacctgcgccgccggatcgcgcccaacttcacgccg
cgcgcgctatccacctatgctgtcatccagcagcgtgtcatcctctcccacctccggcgg
tggatcgaccggagcgttgctaacggcggtaaggccgagcccatacgggtgccctgccgc
gacatgaacctcgagacatcgcagacggtgttcgtcgggccgtacctcaccgtggagacg
agggagaggttcgatagggattacaacctcttcaaccacggtttcataaccttgcccatc
gacctgccagggtccgcgttccggcgcgcgaggcttgccgtaccgcggctgaagcatatt
ctcgaggactgtgcacgtcagagcaagcagcgcatgcgcggcggcggcgagccggagtgc
cttgtggactacttgatgcaggagacggttcgtgagatcgacgaggccgcggcggcgggg
ctgccgccgccaccgcacaccagtgacatggagaccgggaacctcttgtttgacttcctc
ttcgcggctcaggacgcgtccacctcctccctatgctgggccgtgtccgcgctggactcc
cacccggacgtgctcgcccgcgtccgagctgaggtggccgctctctggtcgccggagtca
ggcgagcccatcactgccgagatgatgacggagatgaagtacacccaggcggtggcgcgc
gaagttgtccggtactggcctccaggcccggtggtgccgcacatcgccggcgaggcgttc
cagctgacggagcagtacactatacccaagggcaccatagtgttcccgtcggtgtacgag
tcgtcgttccaagggttccccgacgctggcacgttcgacccggagcgcttcttctcggag
gcgcggagggaggacgtggtgtacaagcgcaacttcctcgcgttcggcgccggcccgcac
caatgcgtcgggcagcgctacgcgctcaaccacctcgtcattttcatggctctcttggcg
tctctcatcgacttccggcgtgagaggacggagggctgcgacgtgccggtgtacatgccg
accatcgtgccgagagacggctgcgtcgtgcacctcaagcagcggtgcgccaagttacca
tcgttctga

DBGET integrated database retrieval system