KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325575
Entry
4325575           CDS       T01015                                 
Name
(RefSeq) alpha-amylase 3, chloroplastic
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4325575
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     4325575
SSDB
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Other DBs
NCBI-GeneID: 4325575
NCBI-ProteinID: XP_015649620
UniProt: B9EZ51
LinkDB
Position
1:29760729..29770032
AA seq 876 aa
MAVASWSIPAIPRAGPTARGVLLGGAFVTAARPPVAWRCRATLPRRVRLGGVVARAGAAE
TPVAGSGEAGLLFSEKFPLRRSRTVEGKAWVRVDAEPDGEGKCKVVIGCDVEGKWVLHWG
VSYDGEQGREWDQPPSDMRPPGSVPIKDYAIETSLDTPHNSEGKTIHEVQIKIDKGTSIA
AINFVLKEEETGAWFQHKGQDFRIPLSGSFGGDLLGTEQDIDVRPGALGHLSNVLQKPEG
PIAEPHKTVPDDKGSRTKHISGFYEEYPILKTVYVQNFITVNVRENNGTTKHAVEFDTDI
PGEVIIHWGVCKDNTMTWEIPPEPHPPATKIFRQKALQTMLQQKADGTGNSLSFLLDGEY
SGLIFVVKLDEYTWLRNVENGFDFYIPLTRADAEADKQKADDKSSQDDGLISDIRNLVVG
LSSRRGQRAKNKVLQEDILQEIERLAAEAYSIFRSPTIDTVEESVYIDDSSIVKPACSGT
GSGFEILCQGFNWESHKSGKWYVELGSKAKELSSMGFTIVWSPPPTDSVSPEGYMPRDLY
NLNSRYGTMEELKEAVKRFHEAGMKVLGDAVLNHRCAQFQNQNGVWNIFGGRLNWDDRAV
VADDPHFQGRGNKSSGDNFHAAPNIDHSQEFVRSDLKEWLCWMRKEVGYDGWRLDFVRGF
WGGYVHDYLEASEPYFAVGEYWDSLSYTYGEMDYNQDAHRQRIVDWINATNGTAGAFDVT
TKGILHSALERSEYWRLSDEKGKPPGVLGWWPSRAVTFIENHDTGSTQGHWRFPFGMELQ
GYVYILTHPGTPAIFYDHIFSHLQPEIAKLISIRNRQKIHCRSKIKILKAEGNLYAAEID
ERVTMKIGAGHFEPSGPTNWVVAAEGQDYKVWEVSS
NT seq 2631 nt   +upstreamnt  +downstreamnt
atggcggtggcgagctggagcattccggcgatcccgcgggcgggtccgacagcgaggggt
gtgctgctcggcggcgccttcgtgacggccgcgcggccgcccgtggcgtggcggtgccgg
gccacgctccctaggagagtgaggctcggtggcgtggtggcccgtgccggtgcggcggag
acgccggtggccggctccggggaagccgggttgctgttctccgagaagttccccttgcgc
cgatcccgaacggtggaagggaaggcgtgggtgagggtcgatgcggagccggatggggag
ggcaagtgcaaggttgtgatcgggtgtgatgtagaggggaagtgggtgctgcattggggt
gtctcctacgatggtgagcagggaagagaatgggaccaacctccttcagacatgagacct
cccggttcagtgcctattaaggactatgcaattgaaacatctttggacactccacacaat
tcagaaggcaagacgattcatgaagtgcaaatcaaaattgataagggcacatcaattgct
gctatcaattttgttctaaaggaagaggaaacaggtgcttggtttcagcacaagggtcag
gatttcagaatacctttaagtggatcctttggtggagatctactaggaacagaacaagat
attgatgtcaggccaggggctttaggtcacctatctaacgtgttacagaaacctgaggga
cctattgctgagcctcataaaactgtacccgatgataaaggttcaagaaccaaacacatt
tcaggtttctatgaggaatacccaatcttaaaaacggtgtatgttcagaattttataact
gttaatgtgagggaaaacaatggaacaactaaacatgctgtggaattcgacactgatatt
cctggagaagttatcattcattggggagtttgcaaagacaataccatgacatgggagatc
cccccagaaccacatccacctgcaacgaagatattccgacagaaagctcttcagaccatg
ctacaacaaaaagctgatggaacaggcaactctctatcattcttactggatggagagtat
tctggtctgatttttgtggtaaaacttgatgagtatacttggttgagaaatgtggagaat
ggatttgatttctacattcctcttacaagagcagacgccgaggctgacaaacagaaagcc
gatgataagtcttcacaagatgatggcttaatcagtgatataaggaatctggtggttggg
ctgtcgtctagaagaggtcagcgagcgaagaataaagttctgcaagaggatatcctacaa
gaaattgagaggttagcggcagaagcttatagcatttttaggagccccacaattgatact
gtagaggaatctgtttacattgatgactcatccattgtgaagcctgcttgttctggtact
ggatctggatttgaaatattgtgtcaaggatttaactgggaatctcataagtcaggaaaa
tggtatgtggaacttggctcaaaggccaaggagttgtcatcgatgggtttcaccattgtc
tggtcaccaccacctactgattctgtgtcgcctgaaggatacatgccaagggatttgtat
aatctaaattccagatatgggaccatggaagagttgaaggaggctgtgaaacgttttcat
gaagccggtatgaaggttcttggtgatgccgtcctgaatcacaggtgtgctcaatttcag
aaccaaaatggcgtctggaatatttttggtggacgccttaactgggatgatcgagcagtt
gttgcagatgatccacatttccagggaagaggaaacaagagcagtggagataacttccat
gcagccccaaacattgatcactcgcaagagtttgtgaggagtgatcttaaagaatggctt
tgttggatgagaaaggaagttggatacgatggatggcgacttgattttgttcgcggattt
tggggtggatatgtccacgattacttggaagcaagcgaaccatattttgcagtaggagag
tactgggattctctcagttacacctatggtgaaatggattataatcaagatgcccacagg
cagagaatagttgattggataaatgctacaaatggaactgctggtgcatttgatgttacc
acgaaaggaatacttcactctgcactggaaagatctgagtactggcgtctgtctgatgaa
aaaggaaaaccccctggagtgttaggttggtggccttcgcgtgctgtcacatttatagaa
aatcatgacactggttctactcagggtcattggagattcccctttggtatggagttgcaa
ggctatgtctacatcttaactcacccaggcactcctgcaatcttctatgatcatatattt
tcgcatttacagccagagattgctaaattaatttctattagaaatcgccaaaagatccat
tgccgtagcaagatcaagatactgaaagcagagggaaatttatatgcggcagagattgat
gagagggtaacaatgaagattggcgcaggacattttgagccaagcggccccacaaactgg
gtagttgctgccgagggacaggattacaaggtctgggaagtgtcatcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328183
Entry
4328183           CDS       T01015                                 
Name
(RefSeq) beta-amylase 8
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4328183
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     4328183
SSDB
Motif
Pfam: Glyco_hydro_14 BES1_N TcdB_toxin_midN
Other DBs
NCBI-GeneID: 4328183
NCBI-ProteinID: XP_015622759
LinkDB
Position
2:1539391..1547343
AA seq 667 aa
MSLKHPHSPVLDGDPPPHRRPRGLVSTPPPPAVAADTSPSPSPSPAAPPPRRRGGGGGGG
EREREREKERTKLRERHRRAITSRMLSGLRQHGNFPLPARADMNDVLAALARAAGWTVHP
DGTTFRASSQPLHPPTPQSPGIFHVNSVETPSFTSVLNSYAIGTPLDSQASMLQTDDSLS
PSSLDSVVVADQSIKNEKYGNSDSVSSLNCLENHQLTRASAALAGDYTRTPYIPVYASLP
MGIINSHCQLIDPEGIRAELMHLKSLNVDGVIVDCWWGIVEAWIPHKYEWSGYRDLFGII
KEFKLKVQAVLSFHGSGETGSGGVSLPKWVMEIAQENQDVFFTDREGRRNMECLSWGIDK
ERVLRGRTGIEAYFDFMRSFHMEFRNLTEEGLISAIEIGLGVSGELKYPSCPERMGWRYP
GIGEFQCYDRYMQKNLRQAALSRGHLFWARGPDNAGYYNSRPHETGFFCDGGDYDSYYGR
FFLNWYSGILIDHVDQVLSLATLAFDGVETVVKIPSIYWWYRTASHAAELTAGFYNPTNR
DGYSPVFRMLKKHSVILKFVCYGPEFTIQENNEAFADPEGLTWQVMNAAWDHGLSISVES
ALPCLDGEMYSQILDTAKPRHDPDRHHVSFFAYRQLPSFLLQRDVCFSELGNFVKCMHGE
ATQIVEG
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgagcctgaagcacccgcactctccggtgctggacggggacccgccgccgcaccgccgc
ccgcggggcctcgtctccaccccacccccacccgccgtcgcggccgacacctccccctcc
ccctccccctcccccgcggcgcctccgcctcggcggcgcggcggcggcggagggggaggc
gagagggagagggagagggagaaggagcggacgaagctgagggagcggcaccgccgggcc
atcaccagccgcatgctgtccgggctgcggcagcacggcaacttcccgctccccgcccgc
gccgacatgaacgacgtcctcgccgccctcgcgcgcgccgcagggtggaccgtgcatccc
gacggcaccaccttccgcgcctcgtcgcaacccctccaccctcccaccccccaatcgcca
gggatttttcatgttaattctgttgaaaccccatcttttactagtgttctcaacagctac
gccatcgggacaccattagactcgcaggcttctatgctacaaacagatgatagtttatcg
ccatcatcgttggactctgttgtggtggcagaccaaagcataaaaaatgagaaatatggg
aattcagattctgtcagctctctgaattgtttggaaaatcaccagctgacgagagcatca
gcagcgctggcaggtgattacaccagaactccatatataccagtctatgcttctctgcct
atgggcattatcaatagccattgccaattgattgatccagagggcatacgtgcagaactg
atgcatctgaagtctttgaatgttgatggagttatcgttgactgttggtgggggatagtg
gaagcctggattcctcacaaatacgagtggtctggttacagggaccttttcggtatcatt
aaagagttcaagctaaaagttcaggctgtattgtcattccatgggtctggggagactgga
tctggtggtgtgtctctcccaaagtgggtcatggaaattgcacaagagaaccaggatgta
ttttttactgatcgtgaaggtaggagaaatatggaatgtctttcctggggaattgacaaa
gagcgagtccttcgcgggagaactggcatcgaggcgtattttgatttcatgaggagcttt
catatggaattcagaaacctgaccgaagagggccttatttctgctatcgaaattggattg
ggtgtttctggagagctaaaatacccttcatgtccagaaagaatgggctggagatatcct
ggtattggtgagtttcagtgttacgacaggtatatgcaaaagaaccttagacaagcagca
ttgtcacggggacatctgttttgggcccgtggacctgataatgcgggctattataattca
agacctcatgaaactggctttttttgtgacggaggtgactatgacagctactatggacgc
tttttccttaactggtattctggaatcctcatagatcatgtggaccaggtgctatcactt
gctactcttgcatttgatggagtcgaaactgttgtgaagattccatctatctattggtgg
tatagaactgcaagccatgctgcggaacttacggcaggattctacaaccctacaaataga
gatggatactctccagtgttcagaatgctcaagaagcattccgtaattctaaagtttgtt
tgttatggaccagaatttacaattcaagagaataatgaagcatttgctgatccagaaggt
ttaacatggcaggttatgaatgcagcatgggatcatggattatctataagtgtagagagt
gctcttccatgtcttgatggtgagatgtactcacagatccttgacacagcgaagcctagg
catgatcctgaccgtcaccatgtctcgttctttgcataccgtcagctaccctcattcctt
ttgcagagagacgtttgcttctcagagcttggcaactttgtcaagtgtatgcacggggag
gctacccagattgtggaaggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330830
Entry
4330830           CDS       T01015                                 
Name
(RefSeq) alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4330830
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     4330830
SSDB
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70 AMT4_dom_C
Other DBs
NCBI-GeneID: 4330830
NCBI-ProteinID: XP_015623650
UniProt: A3ABN7 Q6Z319
LinkDB
Position
2:32243146..32245008
AA seq 428 aa
MASKRFLSLSLLILLLGFSSSLAAGQVLFQGFNWESWKENGGWYNMLMGKVDDIAAAGIT
HVWLPPPSQSVAEQGYMPGRLYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIVINHRTA
EHKDGRGIYCLFEGGTPDSRLDWGPHMICRGDPYGDGTGNPDTGADFGAAPDIDHLNKRV
QRELIGWLDWLKMDIGFDAWRLDFAKGYSADVAKIYIDATEPSFAVAEIWTSLAYGGDGK
PDYDQNAHRQELVNWVDRVGGANSNATTFDFTTKGILNVAVEGELWRLRGEDGKAPGMIG
WWPAKATTFIDNHDTGSTQHMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGHKEEIE
RLVSIRNRQGIHPASELRIMEADSDLYLAEIDGKVITKVGPRYDVEHLIPEGFQVVAHGD
GYAVWEKI
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggcgagcaaacgcttcttgtccctgtccctgctcatcctcctcctcggcttctcctcc
agcttggcagccgggcaagtcctgtttcagggcttcaactgggagtcgtggaaggagaat
ggcgggtggtacaacatgctgatgggcaaggtggacgacatcgccgccgccggcatcacc
cacgtctggctccctccgccgtctcaatctgtcgccgaacaaggctacatgccggggcgg
ctgtacgatctggacgcttccaagtacggcaacgaggcgcagctcaagtcgctgatcgag
gcgttccacggcaagggcgtccaggtgatcgccgacatcgtcatcaaccaccgcacggcg
gagcacaaggacggccgcggcatctactgcctcttcgagggcgggacgcccgactcccgc
ctcgactggggcccgcacatgatctgccgcggcgacccctacggcgacggcaccggcaac
ccggacaccggcgccgacttcggcgccgcgcctgacatcgaccacctcaacaagcgcgtc
cagcgcgagctcatcggctggctcgactggctcaagatggacatcggcttcgacgcgtgg
cgcctcgacttcgccaagggctactccgccgacgtggcaaagatctacatcgacgccacc
gagccgagcttcgccgtggccgagatatggacgtcgctggcgtacggcggggacggcaag
ccggactatgaccagaacgcgcaccggcaggagctggtcaactgggtcgaccgcgtcggc
ggcgccaacagcaacgccacgacgttcgacttcaccaccaagggcatcctcaacgtcgcc
gtggagggcgagctatggcgcctccgcggcgaggacggcaaggcgcccggcatgatcggg
tggtggccggctaaggcgacgaccttcatcgacaaccatgacaccggctcgacgcagcac
atgtggccgttcccctccgacaaggtcatgcagggctacgcctacatcctcacccacccc
ggcaacccatgcatcttctacgaccatttcttcgactggggccacaaggaggagatcgag
cgcctggtatcgatcagaaaccggcaggggatccacccggcgagcgagctgcgtatcatg
gaggctgacagcgatctctacctcgccgagatcgacggaaaggtcatcacgaaggtcgga
ccaagatacgacgtcgagcacctcatccccgaaggcttccaggtcgtcgcgcacggtgac
ggctacgcagtctgggagaaaatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330832
Entry
4330832           CDS       T01015                                 
Name
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4330832
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     4330832
SSDB
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70 AMT4_dom_C
Other DBs
NCBI-GeneID: 4330832
NCBI-ProteinID: XP_015622769
UniProt: P17654 Q0DXA4 B7ES61
Structure
LinkDB
Position
2:complement(32248328..32250199)
AA seq 434 aa
MQVLNTMVNKHFLSLSVLIVLLGLSSNLTAGQVLFQGFNWESWKENGGWYNFLMGKVDDI
AAAGITHVWLPPPSHSVGEQGYMPGRLYDLDASKYGNEAQLKSLIEAFHGKGVQVIADIV
INHRTAEHKDGRGIYCLFEGGTPDSRLDWGPHMICRDDPYGDGTGNPDTGADFAAAPDID
HLNKRVQRELIGWLDWLKMDIGFDAWRLDFAKGYSADMAKIYIDATEPSFAVAEIWTSMA
NGGDGKPNYDQNAHRQELVNWVDRVGGANSNATAFDFTTKGILNVAVEGELWRLRGEDGK
APGMIGWWPAKATTFVDNHDTGSTQHLWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWG
LKEEIERLVSIRNRQGIHPASELRIMEADSDLYLAEIDGKVITKIGPRYDVEHLIPEGFQ
VVAHGDGYAIWEKI
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgcaggtgctgaacaccatggtgaacaaacacttcttgtccctttcggtcctcatcgtc
ctccttggcctctcctccaacttgacagccgggcaagtcctgtttcagggattcaactgg
gagtcgtggaaggagaatggcgggtggtacaacttcctgatgggcaaggtggacgacatc
gccgcagccggcatcacccacgtctggctccctccgccgtctcactctgtcggcgagcaa
ggctacatgcctgggcggctgtacgatctggacgcgtctaagtacggcaacgaggcgcag
ctcaagtcgctgatcgaggcgttccatggcaagggcgtccaggtgatcgccgacatcgtc
atcaaccaccgcacggcggagcacaaggacggccgcggcatctactgcctcttcgagggc
gggacgcccgactcccgcctcgactggggcccgcacatgatctgccgcgacgacccctac
ggcgatggcaccggcaacccggacaccggcgccgacttcgccgccgcgccggacatcgac
cacctcaacaagcgcgtccagcgggagctcattggctggctcgactggctcaagatggac
atcggcttcgacgcgtggcgcctcgacttcgccaagggctactccgccgacatggcaaag
atctacatcgacgccaccgagccgagcttcgccgtggccgagatatggacgtccatggcg
aacggcggggacggcaagccgaactacgaccagaacgcgcaccggcaggagctggtcaac
tgggtcgatcgtgtcggcggcgccaacagcaacgccacggcgttcgacttcaccaccaag
ggcatcctcaacgtcgccgtggagggcgagctgtggcgcctccgcggcgaggacggcaag
gcgcccggcatgatcgggtggtggccggccaaggcgacgaccttcgtcgacaaccacgac
accggctcgacgcagcacctgtggccgttcccctccgacaaggtcatgcagggctacgca
tacatcctcacccaccccggcaacccatgcatcttctacgaccatttcttcgattggggt
ctcaaggaggagatcgagcgcctggtgtcaatcagaaaccggcaggggatccacccggcg
agcgagctgcgcatcatggaagctgacagcgatctctacctcgcggagatcgatggcaag
gtgatcacaaagattggaccaagatacgacgtcgaacacctcatccccgaaggcttccag
gtcgtcgcgcacggtgatggctacgcaatctgggagaaaatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331577
Entry
4331577           CDS       T01015                                 
Name
(RefSeq) beta-amylase 1, chloroplastic
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4331577
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     4331577
SSDB
Motif
Pfam: Glyco_hydro_14 DUF1887
Other DBs
NCBI-GeneID: 4331577
NCBI-ProteinID: XP_015632708
UniProt: Q10RZ1
LinkDB
Position
3:2272950..2276401
AA seq 557 aa
MMSLNLAHQTGAAAAVAPAAPRTAVVAAAAGTVSAPAVAPAAAPSLQLQTQTVDPAAPAQ
GPDLPMAFQALVESLPEEQHPDVGGEERRKVGVPVYVMMPLDTVRKDGNGLNRRKAVEAS
LKALKSAGAEGIMVDVWWGIAECEGPGRYNFTGYMELMEMAKKNGLKVQAVMSFHQCGGN
VGDSVTIPLPKWVLEEMDKDQDLAYTDRSGRRNYEYLSLGADAMPVLKGRTPVQCYGDFM
RAFRDHFAAFMGNTIVEIQVGMGPAGELRYPSYPESNGTWRFPGIGEFQCYDRYMLSSLK
AAAEAVGKPEWGNAGPGDSGGYNDWPEDSPFFRREGGWNTPYGEFFMSWYSQMLLEHGER
ILSAASGVYTGTPGVKISVKVAGIHWHYGTRSHAAELTAGYYNTRHHDGYQPIARMLARH
GAVLNFTCVEMRNHEQPQDAQCRPEELVQQVAAAARESGVGLAGENALPRYDETAHDQIV
TTAAEKAEEERMVAFTYLRMGPDLFQPDNWRRFAAFVKRMTESGVRDVCREQVEREAQGV
AHATGSLVHEAAVALSN
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgatgtcgctcaacctggctcaccagaccggagcggcggccgccgtggcaccggcggcg
ccacgtacggccgtggtcgcggcggctgcgggtacagtgtctgctccggcggtcgcgccg
gcggcggcgccgagcctgcagctgcagacgcagactgtggacccggcggcgccggcgcag
gggccggacctccccatggccttccaggcgctggtcgagagcctgccggaggagcagcac
ccggacgtgggcggcgaggagcggcgcaaggtgggcgtgccggtgtacgtgatgatgccg
ctggacacggtgcgcaaggacggcaacgggctgaaccggcggaaggcggtggaggcgtcc
ctgaaggcgctgaagagcgccggcgccgaggggatcatggtggacgtgtggtggggcatc
gccgagtgcgagggccccggccgctacaacttcaccgggtacatggagctcatggagatg
gccaagaagaacgggctcaaggtgcaggccgtcatgtcgttccaccagtgtggcggcaac
gtcggcgactcagtcactataccacttccgaaatgggtgttggaggagatggacaaggac
caggacctggcctacacggatcggagcggccgccgcaactacgaatacctctcgctcggc
gccgacgccatgccggtgctcaagggccgcacgccggtgcagtgctacggcgacttcatg
cgcgccttccgcgaccacttcgccgccttcatgggcaacaccatagtcgagattcaagtc
ggcatgggtccggccggtgagctccgctacccgtcgtacccggagagcaatggcacctgg
agattccccggcatcggcgagttccagtgctatgacaggtacatgctgagcagtctcaag
gcggcggcggaggcggtgggcaagccggagtggggcaacgccgggccgggagactccggc
gggtacaacgactggccggaggactcgcccttcttccgccgtgaaggtgggtggaacact
ccctacggtgagtttttcatgagctggtactcgcagatgctcctggaacacggcgagcgc
atcctgtcggcggcgtcgggcgtgtacaccggcacacccggcgtgaagatctccgtgaag
gtggccggcatccactggcactacggcacgcggtcccacgccgcggagctgacggcaggg
tactacaacacgaggcaccacgacgggtaccagccgatcgcgcgcatgctggcccgccac
ggcgcggtgctcaacttcacgtgcgtggagatgcgcaaccacgagcagccgcaggacgcg
cagtgccggcccgaggagctggtgcagcaggtggcggccgcggcgcgggagtccggcgtg
gggctcgccggcgagaacgcgctgccgaggtacgacgagacggcgcacgaccagatcgtg
acgacggcggcggagaaggcggaggaggagcgcatggtagcgttcacctacctgcgcatg
gggcccgacctgttccagccggacaactggcgccgcttcgccgcgttcgtgaagcgcatg
acggagtccggcgtgcgggacgtgtgccgcgagcaggtggagcgggaggcgcagggcgtc
gcgcacgccaccgggtcgctcgtgcacgaggccgccgtcgcgctcagcaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335737
Entry
4335737           CDS       T01015                                 
Name
(RefSeq) probable alpha-amylase 2
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4335737
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     4335737
SSDB
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase AMT4_dom_C
Other DBs
NCBI-GeneID: 4335737
NCBI-ProteinID: XP_015635435
LinkDB
Position
4:20005579..20009546
AA seq 415 aa
MGQMVSDENFEEQAARNGGIIKHGREILFQAFNWESHKHNWWSNLEEKVVDLAQSGFTSA
WLPPPTQSLSPEGYLPQNLYCLDSCYGSLHDLQALLRKMKEHNVRAMADVVINHRVGTTQ
GSNGMYNRYDGIPVSWDEHAVTSCSGGKGNESTGDNFDGVPNIDHTQPFVRKDIIDWLIW
LRESIGFQDFRFDFTKGYAAKFVKEYIEQSKPLFAVGEYWDSCEYSPPDYRLNYNQDKHR
QRIINWMDSTGGLCAAFDFTTKGILQEAVKGELWRLRDPEGKPPGVMGWWPSRSVTFVEN
HDTGSTQGHWPFPSDHIMEGYAYILTHPGIPTVFYDHFYGKDDSFHGGIAKLMEIRKCQD
IHSRSAVKILEASSDLYSAIVDDKLCMKIGDGSWCPSGPEWKLAASGDRYAVWHK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgggccagatggtttcggatgaaaattttgaagagcaggccgctcgtaatggtggaatt
atcaagcacggaagggaaatcctgttccaggcttttaactgggaatcccataagcacaac
tggtggagcaatttggaggaaaaagttgttgacctagcacaatcggggtttacatcagcg
tggctgcctccaccaacacagtcattatctccagaaggctatctgccgcagaacctgtac
tgcctcgactcttgttatggttccctccatgacctacaagcattgcttcggaaaatgaaa
gaacacaatgtaagagctatggcagatgttgttattaaccatcgagttgggactactcaa
ggatcgaatgggatgtataatcgttatgatggtatcccagtatcatgggatgaacatgct
gttacatcttgttctggtggaaagggcaacgaaagtaccggtgataacttcgatggggtt
cccaacatagaccatacacagccatttgtacggaaggatattattgactggttgatctgg
cttcgagaaagcattggttttcaagatttccgctttgatttcacgaaaggttatgcagcg
aagtttgtgaaagaatacattgagcaatcaaagcctctttttgcggtgggggaatactgg
gatagctgtgaatatagcccccctgattaccgtttgaactacaatcaggataaacacagg
cagagaattatcaattggatggatagcactggaggactttgtgctgcatttgatttcaca
acaaagggtattcttcaggaagctgtcaaaggtgagttgtggcgtttgcgtgaccctgaa
ggaaagccgcctggtgtcatgggctggtggccttcgagatcagtcacatttgttgaaaat
catgacacaggatccactcagggtcattggccattcccatctgatcatatcatggaggga
tatgcttatatacttactcatcctggcatccccacggtgttctacgatcatttctatggc
aaagatgattccttccatggtggaattgcaaaactgatggagatcaggaaatgccaggac
atacatagccgctccgcagtcaaaatcttggaggccagctcagatctgtactctgcaatc
gttgacgataagttgtgcatgaagatcggggacggctcctggtgcccgagcggcccagag
tggaagctggcggcctctggtgacagatatgctgtttggcacaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342055
Entry
4342055           CDS       T01015                                 
Name
(RefSeq) alpha-amylase isozyme 2A
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4342055
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     4342055
SSDB
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70 AMT4_dom_C
Other DBs
NCBI-GeneID: 4342055
NCBI-ProteinID: XP_015641245
UniProt: Q0D9J1
LinkDB
Position
6:30262783..30266916
AA seq 445 aa
MATGRRLSMILLLLLLGLASGDKILFQGFNWESWRQSGGWYNLLMGKVDDIVAAGVTHVW
LPPPSHSVSTQGYMPGRLYDLDASRYGTSMELKSLISALHGKGIQAIADVVINHRCADYK
DSRGIYCIFEGGTPDGRLDWGPHMICRDDTQFSDGTGNLDTGADFAAAPDIDHLNGVVQR
ELTDWLLWLKSDEVGFDAWRLDFARGYSPEVAKVYIEGTTPVGLAVAELWDSMAYGGDGK
PEYNQDAHRQALVDWVDRVGGTASAGMVFDFTTKGIMNTAVEGELWRLIDQQGKAPGVIG
WWPAKAVTFVDNHDTGSTQQMWPFPSDKVMQGYAYILTHPGNPCIFYDHFFDWGLKEQIA
ALVAVRQRNGVTATSSLKIMLHDADAYVAEIDGKVVMKIGSRYDVSSLIPPGFHLAAHGN
GYAVWEKIAAAAAAADHRTSSSASL
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcgaccggacgacgcctctccatgatcctcctcctcctccttctcggcttggcttcc
ggcgacaagattctcttccaggggttcaactgggagtcgtggaggcagagcggagggtgg
tacaacctgctgatggggaaggtcgacgacatcgtcgccgccggcgtcacgcacgtctgg
ctgccgccgccgtcgcactccgtctccacgcaagggtacatgcctgggcggctgtacgac
ttggatgcgtctaggtacggcacgtcgatggagttgaagtcgttgatcagcgcgctccac
ggcaagggcattcaggcgatcgctgacgtggtgatcaaccaccgctgcgccgactacaag
gacagccgcggcatctactgcatctttgagggcggcacacctgacggccgcctcgactgg
ggcccccacatgatctgccgcgatgatacccagttctccgacggcacaggcaacctcgac
accggcgccgacttcgccgctgcccccgacattgaccacctcaatggtgtcgtccagcgg
gagctcaccgactggctcctctggctcaagtctgacgaggttggcttcgatgcgtggcgg
ctcgacttcgcaagggggtactcgccggaggtggccaaggtgtacattgaggggacaacg
ccggtggggttggcggtggcggagctgtgggactcgatggcgtacggcggagacgggaag
ccggagtacaatcaggacgcacaccggcaggcgttggtggactgggtggacagggtgggt
gggacggcgtcggcggggatggtgttcgacttcacgacgaaggggatcatgaacacggcg
gtggagggggagctgtggcggctgatcgaccagcaggggaaggcaccgggggtgatcggg
tggtggccggcaaaggctgtcaccttcgtcgacaaccacgacactggctcgacgcaacag
atgtggccattcccctccgacaaggtcatgcagggctacgcctacatcctcacccatccc
ggcaacccatgcatcttctacgaccatttcttcgattgggggttaaaggagcagatcgcg
gcgctggtggcggtgaggcagcggaacggcgtgacggcgacgagctcgctcaagatcatg
ctgcacgacgccgacgcctacgtcgccgagatcgacggcaaggtggtgatgaagatcggc
tcccgctacgacgtctccagcctcatcccgcccggcttccacctcgccgcccacggcaac
ggctacgccgtctgggagaaaatcgccgccgccgccgccgccgccgatcatcgcacctct
tccagcgcatcgctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343510
Entry
4343510           CDS       T01015                                 
Name
(RefSeq) beta-amylase isoform X1
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4343510
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     4343510
SSDB
Motif
Pfam: Glyco_hydro_14 DUF2610
Other DBs
NCBI-GeneID: 4343510
NCBI-ProteinID: XP_015645184
LinkDB
Position
7:21470805..21473504
AA seq 631 aa
MPRIHRTKPRTSSKNFQIWTNIARTASLLPIMITTSSPSSQPVRLQQRWTCRSRAASPAP
LLPPPATGRRRRRRLVADSQKTAASLRVRAIAAESEQASPLPEPPPLLTEEEEEEEKMLA
NYVPVYVMLPLGVVTAENELEDAAGLRARLRRLRREAGVDGVMADVWWGIVEGAGPARYE
WRAYRELFRVAQEEGLKVQAIMSFHACGGNVGDAVTIPLPRWVRDVGDDDPDVYYTSPGG
ARNHEYLTIGVDVRPLFHGRTAIQLYADFMKSFRENMGDFLDSGLIVDIEVGLGPAGELR
YPSYPESQGWEFPGIGQFQCYDKYLEEDFRAAATEAGHPEWELPGDAAGEYNYTPEDTRF
FAADGGTYLTEAGRFFLTWYSSKLLEHGDRVLDEANMAFLGCSLKLAAKVSGIHWWYRHP
SHAAELAAGYYNVPGRDGYRPVARMLARHDGAVLNFTCAEMRDSEQPPEAMSSPERLVRQ
ALSAAWREGVEAACENALSRHDRRGYNQMLLNARPNGVGPAGGGGAPPRRVAAVTYLRLS
DELLTATNFRAFKAFVRKMHADQDCCPDPARYGRPMRPLERSGPEVAIERLLDATAPEPP
YPFDGETDMSVGGGLAELIDWVFDKVEWIFC
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgccgagaattcaccggacaaagccaagaacatctagcaaaaattttcaaatttggaca
aacatagcccggacagcttcgctgctgcccatcatgattacaacctcgtcgccatcgtcg
cagccggtcaggctgcagcaacgatggacatgccggagcagagcggcgtctcctgctcct
cttcttccaccgccggcaaccgggcggcggcgtcggcggcggctcgtcgccgactcccag
aagacggcggcttctctccgggtccgtgctattgccgctgagagcgaacaggcttctcct
ctacccgagcctccgccattgctcaccgaggaggaggaggaggaggagaagatgctcgcc
aactacgtccccgtctacgtcatgctcccgctgggcgtggtcaccgcggagaacgagctg
gaggacgcggcggggcttcgggcgcggctgcggcggctgcggcgggaggccggcgtggac
ggcgtcatggcggacgtgtggtggggcatcgtcgagggcgccgggccggcgcggtacgag
tggcgcgcgtacagggagctgttccgcgtggcgcaggaggaaggactcaaggtgcaggcc
atcatgtcgttccacgcctgcggcggcaacgtcggcgacgccgtcaccatcccgctgccg
cgctgggtccgcgacgtcggcgacgacgaccccgacgtgtactacacgagccccggcggc
gcgaggaaccatgagtacctcaccatcggcgtggacgtccggcctctgttccacggcagg
actgccatccagttgtatgccgatttcatgaagagcttcagagagaacatgggtgacttc
ttggactctggcctgatcgtggacatagaggttggcctcggccctgcaggtgagcttaga
tacccatcctacccagagagccaaggttgggaattccccggcatcggacagttccagtgt
tatgacaaatacctggaggaggacttcagagcggcggcgacagaggccgggcacccggag
tgggagctgccgggcgacgccgccggagagtacaactacacgccggaggacacgcggttc
ttcgcggcggacggcggcacgtacctgaccgaggccgggaggttcttcctgacgtggtac
tccagcaagctgctcgagcacggcgacagggtcctcgacgaggcgaacatggcgttcctg
ggctgcagcctcaagctcgccgcgaaggtgtccgggatccactggtggtaccggcacccg
agccacgccgcggagctcgccgcggggtactacaacgtgcccggccgcgacgggtaccgc
cccgtcgcgcgcatgctggcgcggcacgacggcgccgtgctcaacttcacctgcgccgag
atgcgggactcggagcagccgccggaggcgatgagctcaccggagcggctggtgcggcag
gcgctgagcgcggcgtggagggagggcgtcgaggcggcgtgcgagaacgcgctgagcagg
cacgaccggcgcgggtacaaccagatgctgctgaacgcgcggcccaacggcgtcggcccc
gccggcggcggcggcgcgccgccgcgccgcgtcgccgccgtgacgtacctccggctgtcg
gacgagctcctgacggcgaccaacttccgggccttcaaggccttcgtcaggaaaatgcac
gccgatcaggattgctgtccggatccggcccggtacgggaggcccatgaggcctctggag
aggtctgggccggaggtggccatcgagcggctgctggacgcgacggcgccggagccgccg
tatccgttcgacggcgagacggacatgagcgtcggcggcggcctcgccgagttgatcgac
tgggtgttcgacaaggtcgagtggatattctgttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345812
Entry
4345812           CDS       T01015                                 
Name
(RefSeq) alpha-amylase isozyme 3E
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4345812
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     4345812
SSDB
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Gln-synt_C-ter
Other DBs
NCBI-GeneID: 4345812
NCBI-ProteinID: XP_015650698
UniProt: P27934 Q0J528 A3BU20
LinkDB
Position
8:23335165..23337079
AA seq 437 aa
MGKHHVTLCCVVFAVLCLASSLAQAQVLFQGFNWESWRKQGGWYNFLHEKVEEIASTGAT
HVWLPPPSHSVSPQGYMPGRLYDLDASKYGTEAELKSLIEAFHDKNVECLADIVINHRCA
DYKDSRGVYCVFEGGTPDGRLDWGPDMICSDDTQYSNGRGHRDTGAGFGAAPDIDHLNPR
VQRELTDWLNWLRTDLGFDGWRLDFAKGYSAPLARIYVDNTNPTFVVGEIWSSLIYNGDG
KPSTNQDADRQELVNWVEGVGKPATAFDFTTKGILQAAVQGELWRLHDGNGKAPGLMGWM
PDQAVTFVDNHDTGSTQSLWPFPSDKVMQGYAYILTHPGIPCIFYDHVFDWNLQHEIATL
AEIRSRNGIHAESTLDILKAEGDIYVAMIDGKVITKLGPRYDAGGIIPSDFHVVAHGNDY
CVWEKEGLRVPAGRKHY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgggcaagcaccatgtcaccctgtgttgtgtcgtttttgctgtgctctgcctggcgtcc
agcttagcacaagcccaagttctcttccaggggtttaactgggagtcgtggaggaagcaa
ggcgggtggtacaactttctgcacgagaaggtggaggagatcgccagcacgggcgccacc
cacgtctggctcccgccgccgtcgcactctgtctcgccgcagggttacatgccggggcgg
ctctacgacctggacgcgtccaagtacggcacggaggcggagctcaagtcgctgatcgag
gcattccacgacaagaacgtcgagtgcctcgccgacatcgtcatcaaccaccgctgcgcc
gactacaaggacagccgcggcgtgtactgcgtgttcgagggcggcacgcccgacggccgc
ctcgactggggccccgacatgatctgcagcgacgacacgcagtactccaacggccgcggc
caccgcgacaccggcgccgggttcggcgccgcgcccgacatcgaccacctcaacccgcgt
gtccagcgggagctcaccgactggctcaactggctcaggaccgacctcggcttcgacggc
tggcgcctcgacttcgccaagggctactccgcgccgctggcgaggatctacgtcgacaac
accaacccgacgttcgtcgtcggcgagatctggagctcgctcatctacaacggcgacggc
aagccgtcgaccaaccaggacgcggacaggcaggagctggtgaactgggtggagggcgtc
ggcaagccggcgacggcgttcgacttcaccaccaagggcatcctccaggccgccgtgcag
ggcgagctgtggaggctccacgacggcaacggcaaggcgcccggcctcatggggtggatg
cccgatcaggccgtaaccttcgtcgacaaccacgacaccggctcgacccagtcgctctgg
ccgttcccttccgacaaggtcatgcagggctacgcctacatcctcactcaccctggcatc
ccatgcatcttctacgaccatgtgttcgactggaacctgcagcacgagatcgcgacgctg
gctgaaatccggtcaaggaacgggatccatgcggagagcacgctggacatcctcaaggcc
gagggggacatctacgtcgccatgatcgacggcaaggtgatcaccaagctcgggccgagg
tacgacgccggcgggatcatcccctccgacttccatgtcgtggcgcacggcaacgactac
tgcgtctgggagaaggaaggcctcagggttcctgccggtagaaagcactattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345814
Entry
4345814           CDS       T01015                                 
Name
(RefSeq) alpha-amylase isozyme 3D
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4345814
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     4345814
SSDB
Motif
Pfam: Alpha-amylase Alpha-amyl_C2 Glyco_hydro_70 ZinT
Other DBs
NCBI-GeneID: 4345814
NCBI-ProteinID: XP_015650046
UniProt: Q0J527 A0A0P0XHM1
LinkDB
Position
8:23340682..23343286
AA seq 476 aa
MPPDVEVIRHEHIDHPSSTRDRSVVVSSNSLSNTVSAYTDMKNTSSLCLLLLVVLCSLTC
NSGQAQVLFQGFNWESWKQQGGWYNMLKGQVDDIAKAGVTHVWLPPPSHSVAPQGYMPGR
LYDLDASKYGTAAELKSLIAAFHGKGVQCVADVVINHRCAEKKDARGVYCVFEGGTPDDR
LDWGPGMICSDDTQYSDGTGHRDTGEGFGAAPDIDHLNPRVQRELTDWLNWLKSDVGFDG
WRLDFAKGYSTDIAKMYVESCKPGFVVAEIWNSLSYNGDGKPAANQDQGRQELVNWVNAV
GGPAMTFDFTTKGLLQAGVQGELWRLRDGNGKAAGMIGWLPEKAVTFVDNHDTGSTQKLW
PFPSDKVMQGYAYILTHPGVPCIFYDHMFDWNLKQEITALAAIRERNGINAGSKLRIVVA
DADAYVAVVDEKVMVKIGTRYDVGNAVPSDFHQTVHGKDYSVWEKGSLRVPAGRHL
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgccccccgacgtcgaggtcattcgccacgaacacatcgatcatccatcatctacaaga
gatcgatcagtagtggttagcagcaactcactatcgaacacggtttcagcttacacagat
atgaagaacaccagcagcttgtgtttgctgctcctcgtggtgctctgcagcttgacctgt
aactcgggtcaagcacaggtcctcttccagggtttcaactgggagtcgtggaagcagcag
ggtggctggtacaacatgttgaaaggccaagtcgacgacatcgccaaggccggggtcacc
cacgtctggctgccgccgccgtcgcactccgtggcgccgcaggggtacatgccggggcgt
ctctacgacctggacgcgtccaagtacggcacggcggcggagctcaagtcgctgatcgcg
gcgttccacgggaagggcgtccagtgcgtcgccgacgtcgtgatcaaccaccggtgcgcc
gagaagaaggacgcccgcggcgtgtactgcgtgttcgagggcgggacgcccgacgaccgc
ctcgactggggccccggcatgatctgcagcgacgacacgcagtactccgacggcacgggc
caccgcgacaccggcgaggggttcggcgcggcgcccgacatcgaccacctcaacccgcgc
gtccagcgggagctcaccgactggctcaactggctcaagtccgacgtcggcttcgacggc
tggcgcctcgacttcgccaagggatactccacggacatcgctaagatgtacgtcgagagc
tgcaagccgggcttcgtcgtcgccgagatatggaactcgctgagctacaacggcgacggc
aagccggcggccaaccaggaccagggccggcaggagctggtgaactgggtgaacgccgtc
ggcgggccggcgatgacgttcgacttcaccaccaagggcctcctgcaggcgggcgtccag
ggcgagctgtggcggctgcgcgacggcaacggcaaggccgccggcatgatcgggtggctg
ccagagaaggccgtcacgttcgtcgacaaccacgacaccggctcgacgcagaagctttgg
ccgttcccctccgacaaggtcatgcagggctacgcctacatcctcacccaccccggagtc
ccctgcatcttctacgaccacatgttcgactggaacctgaagcaggagataaccgcgctg
gcggcgatcagggagaggaacggcatcaacgccgggagcaagctccggatcgtcgtcgcc
gacgccgacgcatacgtcgccgtcgtcgacgagaaggtcatggtgaagatcgggacgagg
tacgacgtgggcaacgcggtgccgtcggatttccatcagacggtgcacggcaaggactac
agcgtctgggagaaggggtccctccgcgtcccggcggggcggcacctatag

DBGET integrated database retrieval system