KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325632
Entry
4325632           CDS       T01015                                 
Name
(RefSeq) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00360  Phenylalanine metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4325632
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    4325632
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     4325632
SSDB
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 2-Hacid_dh_C GIDA NAD_Gly3P_dh_N F420_oxidored AlaDh_PNT_C XdhC_C NmrA DAO Hydrophob_seed TrkA_N ThiF
Other DBs
NCBI-GeneID: 4325632
NCBI-ProteinID: XP_015621276
UniProt: Q8S1G9 A0A0P0V988
LinkDB
Position
1:33730381..33733000
AA seq 302 aa
MATQATAREIAVVGVIGAGQMGSGIAQLAAAAGCGVLLLDSDTAALSRAVDSISSSLRRL
VAKGQLSQASCEHSIEQIKCVSSVQELRDADLVIEAIVESEDIKKKLFVELDKITKPSAI
LASNTSSISITRLASATNRPCQVIGMHFFNPPPIMKLIEIIRGADTSEEVFTKVKSFSER
LGKTVICSQDYPGFIVNRILMPMINEAFWALYTGVATKEDIDTGMKLGTNHPMGPLQLAD
FIGLDVCLSVLRVLHNGLGDSKYSPCPLLVQYVDAGRLGKKRGQGVYSYRTRSSSIKPRS
SL
NT seq 909 nt   +upstreamnt  +downstreamnt
atggcgacgcaagcgacggcgagagaaattgcggtggtgggagtgatcggcgcggggcag
atgggctcgggcatcgcccagctcgccgccgccgccggctgcggcgtcctcctcctcgac
tccgacaccgccgccctctcccgcgccgtcgactccatctcctcctccctccgccgcctc
gtcgccaagggccagctttctcaggcctcctgtgagcattccatcgagcagattaagtgc
gtctccagtgtgcaagagcttagggatgcggatcttgtgattgaggctatcgtggagtca
gaagacataaaaaagaagctgtttgttgagctggataagatcactaaaccttctgctatt
cttgcctccaatactagctcaatctctataacccgattggcttcagccactaatcgcccc
tgtcaggtgattggtatgcacttttttaaccctcctccgataatgaaattgattgaaatc
atacgtggggctgatacatcagaagaggttttcactaaagtcaaatctttttctgaaagg
cttgggaagacggtaatatgctcacaagactaccctggtttcatcgtgaaccgcatcctc
atgccaatgatcaacgaggcgttctgggcactttacactggagtagcgactaaagaggac
attgatacggggatgaagctaggcacgaatcatcccatgggacctctgcagcttgctgat
ttcattggtttagatgtctgcctttcagtgcttcgggtacttcataatggcctaggagat
agcaaatacagcccttgccctcttctcgttcaatatgttgatgctggccgacttgggaag
aagcgtggacaaggcgtatactcgtataggacaaggtcttcatccattaaaccgaggtca
tctctgtga

DBGET integrated database retrieval system