KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325633
Entry
4325633           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein YqeG
  KO
K01094  phosphatidylglycerophosphatase GEP4 [EC:3.1.3.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4325633
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.27  phosphatidylglycerophosphatase
     4325633
SSDB
Motif
Pfam: PGP_phosphatase Hydrolase_like
Other DBs
NCBI-GeneID: 4325633
NCBI-ProteinID: XP_015621277
LinkDB
Position
1:complement(33733201..33735650)
AA seq 276 aa
MLSPPPVPFLPPTTSRAPPLLPPPRATNPNSADPTTTTAAGMGAAAWWRRSLGQRFNPAG
VAAVAAVAASEPRLALPHVSVQDIRWLDWGELRRAGFRGVVFDKDNTLTAPYAPGLWPPL
AAAFDQCRAAFPPGSLAVYSNSAGLKQYDPDGLEATAIEAVIQGVHVIRHDIKKPGGEAK
EIESYFGCSASNLVLVGDRYFTDVVYGNRNGFLTVLTEPLNFANESYIVRQVRKFEAYLI
SYWYRKGHRPIKHPLLPDARRIVKFDPYNDPMAPAA
NT seq 831 nt   +upstreamnt  +downstreamnt
atgttaagtccaccgccggtgccatttctccctcccaccacttcccgtgccccccctctc
ctaccgccgcccagagcaacaaaccctaacagcgccgaccccacgaccaccaccgccgcc
ggcatgggcgcggccgcgtggtggcggcgctcgctggggcagcggttcaacccggccggc
gtggccgcggtggcggccgtcgcggcgtccgagccgcgcctcgcgctgccgcacgtgtcc
gtgcaggacatccggtggctcgactggggcgagctccgtcgcgccgggttccgcggcgtc
gtgttcgacaaggacaacaccctcaccgcgccctacgcgcccgggctctggccgccgctc
gccgccgcgttcgaccagtgccgcgcggccttcccgccgggctccctcgcggtgtacagc
aactccgcagggttgaaacagtatgatccggatggattagaggcgacggcgattgaggct
gttatccagggggttcatgtgatcaggcatgatataaagaagcctggtggagaagctaag
gaaatagagagttactttggttgttcagcctcaaatcttgttctggttggtgatcgatac
tttactgacgttgtttatggaaacaggaatggttttcttactgttcttacagaaccattg
aattttgcaaatgaatcttacattgtcagacaggttaggaaatttgaagcataccttatc
agttattggtacaggaaagggcacagaccaattaagcacccgttgctccctgatgcaaga
cgaatagtaaagtttgatccatacaatgaccctatggcacctgcagcatag

DBGET integrated database retrieval system