KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325653
Entry
4325653           CDS       T01015                                 
Name
(RefSeq) glutamine--tRNA ligase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4325653
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4325653
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4325653
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     4325653
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4325653
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4325653
 Prokaryotic type
   Other AARSs
    4325653
SSDB
Motif
Pfam: tRNA-synt_1c tRNA_synt_1c_R1 tRNA-synt_1c_C tRNA_synt_1c_R2
Other DBs
NCBI-GeneID: 4325653
NCBI-ProteinID: XP_015621790
UniProt: Q5VRX8 A0A8J8Y8S8
LinkDB
Position
1:complement(4514353..4520608)
AA seq 796 aa
MGTGGGEGDKSAVLPLEALLALGLDQRTAENALVNSKVTANLAAVIAEAGISGCDKTVGN
LLYTVATKYPTNALVHRPVLIDYIVSTKIKNPAQLDAALSFLTNTGPDSLDTGKFEEACG
VGVVVSIEEIKSTVNEVLKHNMEAILEQRYHINVGNLCGQVRKRHPWGDAKATKDEIDKK
LAEILGPKTDADNVKPVKKKKEKAAKVEEKKAAVVTAAPPSEEELNPYSIFPQPEENFKV
HTEIFYSDGNIWRAHNSKEILEKHLKATGGKVMTRFPPEPNGYLHIGHAKAMFIDFGLAK
ERNGHCYLRFDDTNPEAEKKEYIDHIQEIVHWMGWEPYKVTYTSDYFQALYEHAVELIRK
GLAYVDHQTAEEIKEYREKKMNSPWRDRPIEESLKLFEDMRRGLIAEGAATLRMKQDMQN
DNKNMSDLIAYRIKFTPHPHAGDKWCIYPSYDYAHCMVDSLENITHSLCTLEFDIRRPSY
YWLLVALGLYQPYVWEYSRLNISNTVMSKRKLNRLVTEKWVDGWDDPRLLTLAGLRRRGV
SSTAINSFICGIGITRSDNSLIRVDRLEYHIREELNKTASRAMVVLNPLKVVITNLEDEK
VIDLDGKMWPDAPADDASSYYKVPFSRIVYIEKTDFRLKDSKDYYGLAPGKSALLRYAFP
IKCTEVVYGDNPDDIIEIRAEYDPSKTTKPKGVLHWVAQPAPGVEPLKVEVRLFDKLFLS
ENPAELEDWLGDLNPNSKEVIKGAYAVPSLATAVLGDKFQFERLGYFAVDTDSTPENIVF
NRTVTLRDSYGKAGPK
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgggcaccggaggcggcgagggggacaagtcggccgtgctgccgctggaggcgctgctg
gcgctggggctcgaccagcgcacggcggagaacgctctggtcaacagcaaggtcaccgcc
aacctcgccgccgtcatagccgaggctggtataagtggatgtgataagacggttgggaac
ctcctgtacacggttgccactaaatacccaaccaatgcgcttgtccatcgtcctgtactc
attgactatattgtgtcaacgaagataaagaatcctgcacaactagatgctgctctgtca
ttccttactaatactggccctgactctttagatactgggaagtttgaagaagcctgtggt
gtaggtgtggttgtttcaattgaagagattaaatcaacagtcaatgaggtattaaagcat
aatatggaggctatattggagcagcgatatcatattaatgttggtaacctatgcggacag
gttaggaagaggcacccctggggtgatgctaaggcgaccaaggatgaaattgacaagaag
cttgcagagatattaggtccaaagacagatgctgacaatgtaaaaccagtgaaaaagaaa
aaggaaaaagcagcaaaagttgaggagaaaaaagctgcagtagtcactgctgcaccgcca
tctgaggaggaattgaatccatactctatatttcctcagccagaggaaaattttaaggtt
catacagaaatattctatagtgatgggaacatatggagagcgcataacagtaaggagatt
ttagagaaacaccttaaggcaaccggtggaaaagtgatgacccgtttcccaccagaacct
aatggatatcttcatattggtcatgccaaggctatgtttattgattttggactggcgaaa
gagagaaatggtcattgttaccttaggtttgatgacacaaatccagaagccgaaaagaaa
gagtatattgaccacattcaggaaatcgtacactggatgggatgggagccctacaaagtt
acatatacaagtgattatttccaggctttatatgagcatgcagttgagttaatacgaaaa
gggctagcctatgtggatcaccagaccgcagaagaaatcaaggaatacagggaaaagaaa
atgaatagtccatggagggatagacccattgaagaatcactgaaactatttgaagacatg
agacgtgggttgattgctgaaggtgcagcaacactccgaatgaaacaagatatgcagaat
gataacaagaatatgtctgatttaatagcatatagaataaaattcactcctcatccacat
gctggtgataagtggtgcatctatccaagctatgactatgctcactgcatggtggattct
cttgagaacattacacattcgctgtgcacgctcgagtttgacatacgtcgcccgtcatac
tactggctacttgttgccttgggcctgtaccagccatatgtttgggagtattcgaggcta
aacatatcgaatactgtgatgtctaaaagaaagttgaatcgacttgtgacagaaaagtgg
gtagatgggtgggatgaccctcgtttgttgacactagcaggattgcggcgacgtggagtg
tcatcaactgcaattaattcgtttatttgtggaattggaataacaagaagtgacaatagc
ttaattcgggttgaccgtcttgaatatcatatcagagaagagcttaataaaacagcttcc
cgtgccatggttgtgttgaatcctctaaaggttgtaataactaacttggaggatgaaaaa
gtcatagaccttgatggaaaaatgtggcctgatgctcctgcagacgatgcttcatcctac
tacaaggttcctttctcaagaatcgtttacatcgaaaaaactgattttcgtctaaaggac
tcgaaagattactacgggctagctcctggtaaatctgccctgctaagatatgcattcccc
attaaatgtaccgaggttgtttatggtgacaatccagatgacatcattgaaattcgagct
gaatatgacccttcaaagactactaaacctaagggtgttctgcactgggttgctcagcca
gcacctggagttgaaccacttaaggtggaagtaagattatttgataaattattcctctct
gagaatcctgctgaactggaggattggctgggtgatcttaacccgaactcaaaagaggtg
atcaagggtgcctacgccgtgccatcgcttgcgactgcggttcttggtgacaagttccag
ttcgagcggctaggctacttcgcagtggacacagactcgacacctgagaacattgtgttc
aacaggacggttaccctgcgtgattcgtatgggaaagctgggccaaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337996
Entry
4337996           CDS       T01015                                 
Name
(RefSeq) glutamine--tRNA ligase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4337996
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4337996
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4337996
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     4337996
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   4337996
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4337996
 Prokaryotic type
   Other AARSs
    4337996
SSDB
Motif
Pfam: tRNA-synt_1c tRNA_synt_1c_R1 tRNA-synt_1c_C tRNA_synt_1c_R2
Other DBs
NCBI-GeneID: 4337996
NCBI-ProteinID: XP_015639957
UniProt: Q0DK87
LinkDB
Position
5:complement(4976744..4981857)
AA seq 796 aa
MATGEAAAAAASPPELASFLAIGLDQRTAENALANRKVTANLTAVIAEAGVSGCDKSVGN
LLYTVATKYPANALVHRPVVIQYIVSSKIKTPAQLDAALSFLSTLGPDPLDTAKFEETCG
VGVVVSTEEIQSMVTDILKENMEAIVEQRYHINVGSLCGQVRKWHPWGDAKFIKEEIDKR
LTEILGPKTEADNVKPVKKKKEKPAKVEEKKTAVAAPAPPSEEELNPYSIFPQPEENLKV
HTEIFFSDGNIWRAHNRKDILEKHLKATGGKVMTRFPPEPNGYLHIGHAKAMFIDFGLAK
ERNGHCYLRFDDTNPEAEKKEYIDHIQEIVRWMGWEPYKVTYTSDYFQELYELAVCLIKK
GLAYVDHQTPEEIKEYREKQMNSPWRDRPIEESLKLFEDMRHGLVAEGKATLRMKQDMQN
DNKNMADLIAYRIKFTPHPHAGDKWFIYPSYDYAHCLVDSLENITHSLCTLEFDIRRPSY
YWLLVSLDQYQPYVWEYSRLNISNNVMSKRKLNKLVTEKWVDGWDDPRLLTLAGLRRRGV
SSTAINSFIRGMGITRSDNSLIRLERLEYHIREELNKVAPRAMVVLHPLKVVINNLDYGT
IIDLDAKKWPDAPGDDASAYYKVPFSRTVYIEQSDFRVKDSKDYYGLAPGKTVLLRYAFP
IKCTEVIYGDNSDNIIEIRAEYDPSKATKPKGVLHWVAEPSPGVNPLKVEIRLFEKLFLS
ENPVELEDWLGDLNPRSKEVIKGAYAVPSLATAALGDKFQFERLGYFAVDSDSTAEELVF
NRTVTLRDSYGKAGPK
NT seq 2391 nt   +upstreamnt  +downstreamnt
atggcgaccggagaagcggcggcggcggcggcgtcgccgccggagctggcgtcgttcctg
gcgatcgggcttgaccagcgcacggcggagaacgccctcgccaaccgcaaggtcaccgcc
aacctcaccgccgtcatcgccgaggctggtgttagtgggtgtgacaaatctgtggggaat
cttctctacactgtcgcgacgaagtatccggcgaatgccctggtgcatcgtcccgttgtc
atccaatacattgtgtcgtcaaagatcaagacccccgcgcaattagatgctgctctgtcg
tttctttctactttgggtcctgatccattggacacagcaaagtttgaagagacatgtgga
gtgggggtggttgtttcaactgaagagattcagtcaatggtcactgatatcctgaaggaa
aacatggaagccatagttgaacagcgatatcatataaatgttggcagcttgtgcggacag
gttaggaagtggcacccctggggcgatgctaagttcataaaggaggaaattgataaaagg
cttacagagattcttggtccaaagacagaagctgacaatgtaaagcctgtgaaaaagaag
aaggagaagcccgcaaaagttgaggagaaaaaaactgcggtagctgctcctgctccacca
tctgaggaagaacttaatccctactccatatttcctcaaccggaggaaaacttaaaggtc
catacagaaattttcttcagcgatggaaatatatggagagcacacaacagaaaggacatt
ttagagaaacatcttaaagcaactggaggaaaagtgatgacccgctttcccccagagcct
aatggctaccttcatattggtcatgctaaggctatgtttattgattttggactggctaaa
gagcgcaacggacattgttaccttaggtttgatgatacaaaccctgaggcggagaagaaa
gaatatatagatcacattcaagaaattgtccgatggatgggctgggagccttataaagtt
acctatacaagtgactatttccaagaattatatgaacttgctgtttgtttgataaagaag
ggactagcttatgtcgatcaccagacaccagaagagataaaggagtatagagaaaagcaa
atgaatagtccatggagggataggcctatagaagagtcactaaaactgtttgaagatatg
aggcatgggttggttgctgagggaaaggcaactcttaggatgaaacaagacatgcagaat
gataacaagaacatggctgacttaatagcatatagaataaagtttacacctcatccccat
gctggcgacaagtggtttatctatccaagctatgactatgctcattgtttggttgactct
cttgaaaacattacccattcgttgtgcacactagaatttgacatacgtcgtccttcatac
tactggctgctcgtatccctggaccagtaccagccatatgtttgggaatattcaaggtta
aacatatcaaacaatgttatgtccaagcgaaagctaaataaacttgtgacagagaagtgg
gtagatgggtgggatgatcctcgcctgttgacacttgcaggactacggcggagaggagta
tcatcaacagcaattaactcctttattcgtggaatgggcataacaaggagtgacaacagt
ttgatacgcttagaacgccttgagtatcatattagagaagagctcaacaaagtagctcct
cgtgctatggttgttttgcatcccctaaaggttgttataaataatttagactatggaaca
ataatagaccttgatgcaaaaaagtggcccgatgctccaggagatgatgcttcggcctat
tacaaggttccattctcaagaactgtctacatcgagcagtctgattttcgtgtaaaggat
tcaaaagattattatgggcttgctcctggtaaaacagtactactaaggtatgcattccca
ataaaatgtacggaagttatctatggtgataattcagataatatcattgaaatccgagct
gagtatgacccttcgaaggctacaaaaccaaagggtgtgttgcactgggttgccgaacct
tctccaggtgttaacccgctcaaagtggaaatcagattgttcgagaaattatttctttca
gagaatcctgtggagcttgaggattggctgggtgatctcaacccacgatcaaaggaagtg
ataaagggtgcctatgccgtgccttcgcttgcaactgcagcgctgggggacaaatttcag
tttgaacgcctcggttactttgctgtggattccgactcgacggctgaggaacttgtgttc
aacagaaccgttactctacgggattcctatggaaaagctggacccaagtga

DBGET integrated database retrieval system