KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325716
Entry
4325716           CDS       T01015                                 
Name
(RefSeq) leucoanthocyanidin dioxygenase
  KO
K05277  anthocyanidin synthase [EC:1.14.20.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00941  Flavonoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4325716
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.4  anthocyanidin synthase
     4325716
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Other DBs
NCBI-GeneID: 4325716
NCBI-ProteinID: XP_015647276
UniProt: Q93VC3
LinkDB
Position
1:complement(15346351..15348187)
AA seq 375 aa
MTDVELRVEALSLSGVSAIPPEYVRPEEERADLGDALELARAASDDDATARIPVVDISAF
DNDGDGRHACVEAVRAAAEEWGVIHIAGHGLPGDVLGRLRAAGEAFFALPIAEKEAYAND
PAAGRLQGYGSKLAANASGKREWEDYLFHLVHPDHLADHSLWPANPPEYVPVSRDFGGRV
RTLASKLLAILSLGLGLPEETLERRLRGHELAGVDDDLLLQLKINYYPRCPRPDLAVGVE
AHTDVSALSFILHNGVPGLQVHHAGSWVTARPEPGTIVVHVGDALEILTNGRYTSVLHRG
LVSRDAVRLSWVVFCEPPPESVLLQPVPELLADGADKPLFAPRTFKQHVQRKLFEKLKDQ
QDNNAAAASNGMRTK
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgacggatgtggagctgagagtggaggccctcagcctcagcggcgtctccgccatcccg
ccggagtacgtccgcccggaggaggagcgcgccgacctcggcgacgccctggagctcgcc
cgggccgcgtccgacgacgacgccaccgcccgcatccccgtcgtcgacatctccgcgttc
gacaacgacggcgacggcaggcacgcgtgcgtggaggcggtgcgcgcggcggcggaggag
tggggcgtcatacacatcgccggccacggcctcccgggcgacgtcctcggccgcctgcgc
gccgcgggcgaggcgttcttcgcgctgcccatcgcggagaaggaggcgtacgccaacgac
ccggcggcggggcggctgcaggggtacggcagcaagctcgccgccaacgccagcgggaag
agggagtgggaggactacctgttccacctcgtccacccggaccacctcgccgaccactcg
ctctggccggcgaacccgccggagtacgtccccgtgtcgcgcgacttcggcggccgcgtc
cggaccctcgcatccaagctgctcgccatcctctccctcggcctcggcctgccggaagag
acgctggaacgccgcctgagaggacatgagctggccggcgtcgacgacgacctgctcctt
cagctcaagatcaactactacccgaggtgcccgcggcctgacctcgccgtcggcgtcgag
gcacacaccgacgtcagcgcgctctccttcatcctccacaacggcgtgccggggctgcag
gtgcaccacgccgggagctgggtcaccgcgcgccccgagccgggcaccatcgtcgtccac
gtcggcgacgccctggagatcctcaccaacggccggtacaccagcgtgctccaccgcggc
ctcgtcagccgcgacgccgtgcgcctctcctgggtcgtcttctgcgagccgccgcctgag
tccgtgctgctgcagccggtgccggagctgctcgccgacggcgccgacaagccgctcttc
gcgccgcgcacattcaagcagcacgtgcaacgcaagctgttcgagaagctcaaggatcag
caagacaacaatgccgcagctgcatcgaacggaatgagaactaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341576
Entry
4341576           CDS       T01015                                 
Name
(RefSeq) leucoanthocyanidin dioxygenase
  KO
K05277  anthocyanidin synthase [EC:1.14.20.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00941  Flavonoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4341576
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.4  anthocyanidin synthase
     4341576
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Other DBs
NCBI-GeneID: 4341576
NCBI-ProteinID: XP_015641525
UniProt: Q67VR7
LinkDB
Position
6:complement(25295321..25297440)
AA seq 373 aa
MTDVELRVEALSLSDVSAIPPEYVRLEEERTDLGDALEVARAASDDADAARIPVVDISAF
DGDGRRACVEAVRAAAEEWGVMHIAGHGLPGDVLDRLRAAGEAFFALPIAEKEAYANDPA
AGRLQGYGSKLAANASGKREWEDYLFHLVHPDHLADHSLWPANPPEYVPVSRDFGGRVRT
LASKLLAILSLGLGLPEETLERRLRRHDQHGVDDDLLLQLKINYYPRCPRPDLAVGVEAH
TDVSALSFILHNGVPGLQAHHAGTWVTARSEQGTIVVHVGDALEILTNGRYTSVLHRSLV
SRDAVRVSWVVFCEPPPESVLLQPLPELLANGAGKPLFAPRTFKQHVQRKLFKKLKDQQD
NNAAAASNGIIPK
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgacggacgtggagctgagagtggaggccctcagcctgagcgacgtctccgccatcccg
ccggagtacgtccgcctggaggaggagcgcacagacctcggcgacgccctggaggtcgcc
cgggccgcgtccgacgacgccgacgccgcccgcatccccgtcgtcgacatctccgcgttc
gacggcgacggcaggcgcgcgtgcgtggaggcggtgcgcgcggcggccgaggagtggggc
gtcatgcacatcgccggacacggcctcccgggcgacgtcctcgaccgcctgcgtgccgcg
ggcgaggcgttcttcgcgctgcccatcgcggagaaggaggcgtacgccaacgacccggcg
gcggggcggctgcaggggtacggcagcaagctcgccgccaacgccagcgggaagagggag
tgggaggactacctgttccacctcgtccacccggaccacctcgccgaccactcgctctgg
ccggcgaacccgccggagtacgtccccgtgtcgcgcgacttcggcggccgcgtccggacc
ctcgcgtccaagctgctcgccatcctctccctcggcctcggcctgccagaagagacgctg
gaacggcgcctgagaagacatgatcagcacggcgtcgacgacgacctgcttctccagctc
aagatcaactactacccgaggtgcccgcggcctgacctcgccgtcggcgtcgaggcacac
accgacgtcagcgcgctctccttcatcctccacaacggcgtgccgggactgcaggcgcac
cacgccgggacctgggtcaccgcgcgctccgaacagggcaccatcgtcgtccacgtcggc
gacgccctggagatcctcaccaacggccggtacaccagcgtgctccaccgcagcctcgtc
agccgcgacgcagtgcgcgtctcctgggtcgtcttctgcgagccgccgccggagtccgtg
ctgctgcagccgctgccggagctgctcgccaacggcgccggcaagccgctcttcgcgccg
cgcacattcaagcagcacgtgcaacgcaagctgttcaagaagctcaaggatcagcaagac
aacaatgccgcagctgcatcgaacggaattatacctaaataa

DBGET integrated database retrieval system