KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325717
Entry
4325717           CDS       T01015                                 
Name
(RefSeq) asparagine--tRNA ligase, cytoplasmic 3
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4325717
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4325717
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4325717
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     4325717
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4325717
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4325717
 Prokaryotic type
    4325717
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon WHEP-TRS tRNA-synt_2d Desulfoferrodox
Other DBs
NCBI-GeneID: 4325717
NCBI-ProteinID: XP_015621402
UniProt: A0A0P0V2L3 Q93WM3
LinkDB
Position
1:complement(15356779..15360682)
AA seq 559 aa
MAEDAAAAAMAAASLSDDLEPATDRTRIRSILADGAARAGERVVVGGWVKTGREQGKGTF
AFLELNDGSCASNLQVLVDAAVHPLAPLTATGTSVLVEGELKKPPEGAKQRVELRVDRVI
EVGEVDPAAYPLPKTKLTLENLRDVVHLRSRTNTIGAVARIRHQLACATHRFFDENGFLY
VHTPIITTSDCEGAGEMFQVTTLFSHAEKVEKELKENPAPSESDIEAARVVVKEKGDAVA
QLKAAKASKQEITAAVAELNKAKENVSRLEERSKLKPGIPYRDDGTVAYENDFFKRQAFL
TVSGQLQVETYACALSSVYTFGPTFRAENSHTSRHLAEFWMVEPEIAFANLQDDMNCAER
YVQYLCKWLLEHCREDMEFMVKNYDKTAIERLELVSSTPFQRISYTKAVELLKNVTDKKF
ENKVEWGIDLASEHERYLTEVIFKKPVIVYNYPKEIKAFYMRLNDDQKTVAAMDVLVPKV
GELVGGSQREERLDLLKTRIQDAGLPLEPYEWYLDLRRFGSVKHSGFGLGFERMILFATG
LENIRDVIPFPRYPGRADL
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggccgaagacgccgcggcggccgccatggccgcggcctccctctccgacgacctggag
cccgccaccgaccgcacccgcatccgatccatcctggccgacggcgccgcgcgcgccggc
gagcgcgtcgtcgtgggcgggtgggtcaagaccgggcgggagcaggggaaaggcaccttc
gccttcctcgagctcaacgatggctcctgcgcctccaacctgcaggtcctcgtcgacgcc
gccgtccacccgctcgcgccgctcaccgccacgggcacgtccgtgctcgtcgagggcgag
ctcaagaagccgccggagggcgccaagcagcgcgtcgagctccgcgtcgaccgcgtcatc
gaggtcggcgaggtcgaccccgccgcctacccgctgcccaagaccaagctcacgctcgag
aatctcagggacgtcgtccatctccgctcccgcaccaacacgattggtgctgttgcgcgt
attagacaccagctagcctgtgcaacacacaggttttttgatgagaatggttttctttat
gtgcacacaccaataataactacaagtgattgtgagggtgctggtgagatgtttcaagtg
acgactttgttcagccatgctgaaaaggtggagaaggaattgaaagagaaccctgcacca
tcagagtctgatattgaggcagctagagttgttgtcaaggaaaaaggtgatgcggttgca
cagcttaaagctgcaaaagctagcaaacaagaaatcacagctgctgttgctgagcttaac
aaggcaaaagaaaatgtctcaaggctggaggaaagatctaagttgaagcccggaattccg
tacagagatgatgggacagtagcttatgagaatgacttcttcaaacgccaggcttttctg
actgtgtctggacagcttcaagttgagacctatgcatgtgctcttagcagtgtttatacc
tttggaccaacattccgtgcagaaaactcccatacatcacgacatttggcagagttttgg
atggttgaaccagaaatcgcatttgctaacttgcaggatgatatgaactgtgcagaaaga
tatgtacagtacctttgcaagtggcttcttgagcattgccgggaagacatggaattcatg
gtgaaaaattacgataagactgcaattgagcgtctggagcttgtttcctcgacacctttt
cagcgcatttcatatacaaaagctgttgagctattgaaaaatgtcactgataagaaattc
gaaaacaaggttgaatggggaattgatttagcttcagagcatgaaaggtatttaaccgag
gtgatatttaagaagccggtgattgtttataactatcccaaagaaataaaggcattttat
atgagactcaatgatgatcagaagactgtagctgctatggatgttcttgtgcccaaggtt
ggtgagttggttggtggaagccaaagggaggaacgtctggaccttctcaaaacaaggata
caagacgccgggttgcctttggagccatatgaatggtacttggacctccgccgctttgga
tctgtcaagcacagtggttttggtttgggttttgaaagaatgattctttttgccactggt
ttggagaacatcagagatgtcatccccttccctagatacccagggagggctgatctctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343250
Entry
4343250           CDS       T01015                                 
Name
(RefSeq) asparagine--tRNA ligase, chloroplastic/mitochondrial isoform X1
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4343250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4343250
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4343250
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     4343250
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4343250
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4343250
 Prokaryotic type
    4343250
SSDB
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d DAZAP2
Other DBs
NCBI-GeneID: 4343250
NCBI-ProteinID: XP_015644846
LinkDB
Position
7:17838530..17844981
AA seq 566 aa
MAAAAATRLLRLAPRRLQGPPRACPFAALPLHPTPARLAATTSRWRRFCAAAQASAPPPP
PAATAAAAAASGEAVGEFRRRTRVADVKGGEDEGAAWVGKQLAVRGWVRTCRAQRTVTFV
EVNDGSCLSNMQCVLTPDTEGYDQIDSITTGASVLVEGVIASSQGGKQKVELKVSKISVI
GESDPTSFPIQKKRASREFLRTVAHLRPRTNTFGAVARVRNALAYATHKFFQDNGFVWVA
SPIITASDCEGAGEQFYVTTLISNSAEGGSLVKDIPSTKDGRVDWSQDFFCKPAFLTVSG
QLNGETYATALSDVYTFGPTFRAENSNTSRHLAEFWVFFLLVCVPGKMIEPELAFADLND
DMACASSYLQYVVKYVLENCKEDMDFFNTWIEKGIIDRLNDVVEKNFVHLSYSDAIELLV
GSKKKFEFPVKWGLDLQSEHERYITEVAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAM
DLLVPRVGELIGGSQREERLDYLEARLDELNLNKDSYWWYLDLRRYGSVPHAGFGLGFER
LVQFATGMDNIRDTIPFPRVPGSAEF
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggcggccgccgcggcgacccgcctcctccgccttgccccgcgccgcctccagggccca
cccagggcgtgcccgttcgccgccctcccgctccacccgacgccggcccggctcgccgcc
accacctcgaggtggcgccgcttctgcgccgccgcgcaggcctcggcgccgcccccgcca
ccggccgccacggcggcggcggcggcggcctcgggggaggccgtgggggagttcaggaga
cggacgcgggtggcggatgtcaagggaggggaggacgagggcgccgcgtgggttggaaag
cagctcgccgtgcgcgggtgggtgcgcacctgccgcgcccagaggaccgtcaccttcgtc
gaggttaatgatggttcttgcttgtccaacatgcaatgtgtattgactcctgatacagaa
ggctacgaccagatagactctatcactactggggcctctgtgttagtggaaggagttata
gcaagcagccaaggtggtaaacaaaaagtggagttgaaggtttcaaagatcagtgtgatt
ggagaaagtgatccaacatcttttcctatacaaaagaagcgggcatcaagagaatttctg
agaactgtagcccatctccgtcctcggacaaatacttttggcgcagtggcaagagtgaga
aatgctttggcatacgcaacccacaaattttttcaagacaacggatttgtttgggtagca
agccctattatcacagcatcagactgtgaaggagcaggggagcagttttatgtgacaaca
ttgatttcgaatagtgctgaaggtggttctctagtcaaggatattccttctactaaggat
ggaagggttgattggtcacaggatttcttctgcaaaccagcatttctgacagtgtctggg
caactgaatggtgaaacatacgctacagctctatcagatgtttacacttttggtccaaca
tttagagctgaaaattcaaacacctcaagacatttggctgaattttgggttttttttttg
ttggtttgtgttccggggaagatgattgagcctgaacttgcctttgcggatctaaatgat
gacatggcatgtgcgagttcatatctccagtatgtagtgaagtatgttctagagaactgc
aaagaagatatggatttctttaatacatggattgaaaaagggatcatcgatagattaaat
gacgtagttgagaaaaactttgttcacttgtcatattctgatgctattgagctacttgtt
gggtccaagaagaaatttgagttcccggtcaaatggggattggatctgcaaagtgagcat
gaaagatatatcacagaagttgcttttggtgggcgcccggtgataattagagattatcca
aaggaaatcaaagctttctatatgcgagagaatgatgatggtaaaacagttgctgcaatg
gatctattggttcctcgggttggtgaactcattggtggaagccaaagggaagaacgtctt
gattaccttgaagctcgcttggatgagttaaatcttaacaaagatagctactggtggtac
ttagatctacgtcgatatggatcagttcctcatgctggttttggtcttggatttgaaaga
ctagtacagtttgcaactggaatggacaacattagagacaccattccatttccccgggtt
ccaggctctgcagagttttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352065
Entry
4352065           CDS       T01015                                 
Name
(RefSeq) asparagine--tRNA ligase, cytoplasmic 2
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4352065
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4352065
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4352065
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     4352065
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   4352065
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4352065
 Prokaryotic type
    4352065
SSDB
Motif
Pfam: tRNA-synt_2
Other DBs
NCBI-GeneID: 4352065
NCBI-ProteinID: XP_015619090
UniProt: Q2QSX5 A0A8J8YAX2
LinkDB
Position
12:complement(12762895..12765797)
AA seq 615 aa
MAASSSSTSFSSSSSHEGDAGSSYIECFKYSRRATLRSVVGRPDGGAGLVGERAVVGGWV
RSSAVVRARRAAAGPASPSRKPEVEATGLTCTEVLMSRVPLIRCIARLMAGGITAAASAG
GSARRPAVGTALVRINDGSCVADLQIVVDSALLPLDQITATGACVLVEGKIEQVEGTLPQ
YVVQMKVEKILHIGPVDSEKYPRSNAHSSPDLVRGYPHLAARTATVASTARVRSELVHAV
HAFFQSNGFFHVNTPTITTTTATSAGNRGKMLRLTRLFSKSDNGNRITPEAVRAAIKEKT
KQVEALKRSESNKEALEAAEQDLQRANALSRQLEQGASAESSQDEFFHRPAYLTPCHTLH
LETYACALSSVYTFSPVFQAESESLDSDRSLAERWTVDVELAFAELEDAISCAEDCVKSL
CSTVSKDCSDELKFLSSNQAGDATSSVIEAAVSSPWQKIKYTEAVNTLLQVTDKTFESKL
ELGMPLSRVHLSYLADDLYKKPVIIYDYPKQLKPFYARLKEDLKTVSAFDLVVPKVGIVA
CGAQKEERMDNLTSRIEESGLQVEQLEWYLDTRRHGTVKHSGFSIDLESLILFVTGLKDV
RDAIPFHRTKGHAKC
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggcggcctcctcctcctccacgtcgttctcttcgtcttcgtcccacgaaggagacgcg
ggctcgtcgtacatagagtgcttcaagtactcgaggcgcgccacgctccgctccgtcgtt
ggccgccccgacggcggcgccgggctggtcggggagcgcgcggtggtcggcggatgggtg
aggtcgtccgccgtcgtcagggcgaggcgcgctgctgctggccccgcgtcgccgtcgagg
aagcccgaggtggaggccaccgggctgacgtgcacggaggtgctcatgtccagggtgcca
ctcatccgctgcatcgccaggctcatggccggtgggatcaccgccgccgcctcggcgggc
ggatccgctcgccggccggccgtcggcacggcgctggtgcgcatcaacgacggctcctgc
gtggctgatctccagatagttgtggactctgcactgttgcctcttgatcaaatcaccgct
actggagcttgtgttcttgtggaaggcaagatagagcaggtggaagggacattgccgcag
tatgttgtgcagatgaaggtggagaagattctgcacattggtcctgtggattcagagaag
taccctaggtcgaatgctcattcatctccggatcttgtcaggggctacccgcatctcgct
gctcgtacagcgacggttgcatcaactgctcgtgtacggagtgaattggtccatgctgtc
cacgcatttttccaatccaacggattcttccatgtgaatacacccacgataacaacaaca
acagcaaccagtgcaggaaaccgcggcaaaatgttacgattaacccgccttttcagcaaa
tcagacaatggcaataggatcacacctgaagctgtcagggctgccatcaaggagaagacg
aaacaagttgaagcactaaagagaagcgaaagcaacaaagaagccctcgaagctgcagag
caggatcttcagagggcaaatgctctttcaaggcagctcgagcaaggagcaagtgcagag
tcctcccaagatgagttctttcaccgcccagcctacctgacaccttgccatacacttcat
ctcgagacatacgcctgtgcactcagcagcgtctacacattcagcccggtgttccaggct
gagagtgagagcttggattcagacaggtctctggctgagaggtggacagtcgatgtcgag
ctcgctttcgccgagcttgaggatgcaatctcctgcgccgaggattgtgtgaagtcactc
tgcagcacggtgtcgaaagattgttcagatgagctgaagtttctgtcgtccaatcaggca
ggtgatgccactagtagcgttattgaagctgcagtgtcaagcccctggcaaaagattaag
tacactgaagctgtcaatactcttcttcaggtcacggataaaacttttgaatcgaaactt
gagttgggcatgccactgtctcgtgtgcatctgagttatctggctgatgatttatacaag
aagccagtaatcatatatgattacccgaaacagctaaagccattttatgcacgcctgaag
gaagacctgaagacagtctctgcctttgacttagttgtgccaaaggttggcatcgtagca
tgtggagctcagaaggaggaaaggatggataatttaacctcaaggattgaggagtcaggg
ctgcaggttgagcagctggaatggtatttggacacacgcagacatggcactgtaaagcac
tctggtttcagcatagacttggagagcctcatcttatttgtcaccggcctcaaggatgtc
cgagacgccatccccttccatcgaaccaaaggtcatgcaaaatgttag

DBGET integrated database retrieval system