KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325735
Entry
4325735           CDS       T01015                                 
Name
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4325735
   04120 Ubiquitin mediated proteolysis
    4325735
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4325735
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     4325735
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 CagA
Other DBs
NCBI-GeneID: 4325735
NCBI-ProteinID: XP_015619069
UniProt: Q5ZC88
LinkDB
Position
1:complement(15130924..15139599)
AA seq 744 aa
MATHERKTIDLEQGWEFMQKGITKLKNILEGKPEPQFSSEDYMMLYTTIYNMCTQKPPHD
YSQQLYEKYRESFEEYITSMVLPSLREKHDEFMLRELVKRWSNHKVMVRWLSRFFHYLDR
YFISRRSLPQLSEVGLSCFRDLVYQEIKGKVKSAVISLIDQEREGEQIDRALLKNVLDIF
VEIGLTSMDYYENDFEDFLLKDTADYYSIKAQTWILEDSCPDYMLKAEECLKREKERVAH
YLHSSSEQKLLEKVQHELLTQYASQLLEKEHSGCHALLRDDKVDDLSRMYRLFSRITRGL
EPVSQIFKQHVTNEGTALVKQAEDAASNKKPEKKEIVGLQEQVFVRKIIELHDKYVAYVT
DCFQGHTLFHKALKEAFEVFCNKGVSGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLE
KVVRLLAYISDKDLFAEFYRKKLARRLLFDKSANDEHERSILTKLKQQCGGQFTSKMEGM
VTDLTVARDHQAKFEEFISTHSELNPGIALAVTVLTTGFWPSYKSFDINLPAEMVKCVEV
FKEFYQTRTKHRKLTWIYSLGTCNINAKFEAKTIELIVTTYQAALLLLFNGVDRLSYSEI
VTQLNLSDDDVVRLLHSLSCAKYKILSKEPNNRSISPNDVFEFNSKFTDKLRRLKIPLPP
VDEKKKVVEDVDKDRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKR
IEDLITRDYLERDKDNPNVYRYLA
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggcgacccacgagcggaagacgatcgatctggagcaggggtgggagttcatgcagaag
ggcatcaccaagctgaagaacatcctcgaggggaagcccgaaccccagttcagctccgag
gactacatgatgctctacacgacgatttacaacatgtgcacgcagaagccgccgcacgac
tactcgcagcagctctacgagaagtaccgcgagtccttcgaggagtacatcacgtccatg
gtcttaccttcattaagagagaaacatgatgagtttatgctgagagagctagtaaaacgg
tggtcaaaccataaagtgatggttcggtggctatcacgcttcttccattatcttgatcgg
tactttatttcaaggaggtccctaccacaactaagtgaagttgggcttagctgtttccgg
gatctggtatatcaagagatcaaaggaaaagtaaaaagtgcggtgatatccttgatagat
caagaacgtgagggtgaacaaattgatagggccctgttaaagaatgttctggatatattt
gttgagattggcttgactagcatggactactacgaaaatgattttgaagatttcttgctc
aaagatactgcagactattactctataaaagcccagacctggattcttgaggactcttgt
ccagattacatgttaaaggcagaggagtgtctgaaaagggagaaagagcgagttgctcat
tatttgcactccagtagtgaacagaagttgttggagaaagtgcaacatgagttgctaact
caatacgcaagtcagctcctggagaaggagcattctggatgccatgcattgcttcgtgat
gacaaggttgatgatctctctagaatgtacaggctcttttccagaataactcgtggttta
gaacctgtttctcaaatatttaagcagcatgttactaatgagggcactgccttagtgaag
caagccgaagatgctgctagtaataagaagccagagaagaaggagatagttggtttacag
gaacaggtttttgtccggaaaatcattgagcttcatgacaagtatgtagcttatgttacg
gattgttttcaggggcacactctcttccataaggcacttaaggaggcttttgaagttttt
tgcaacaaaggtgtttctggcagttcaagtgctgaattactagctaccttctgtgacaat
atcttaaagaaaggcggtagtgaaaagcttagtgatgaagcaattgaagatacccttgag
aaggttgtaaggttacttgcctacattagtgacaaggacttgtttgctgagttctataga
aagaagcttgcaaggagattgctttttgacaagagtgctaatgatgaacatgagagaagc
atccttaccaagctaaagcaacaatgtggagggcagttcacttccaaaatggagggcatg
gttactgatctcactgtggcaagagatcaccaggctaaatttgaagagttcataagcaca
cactcagagttgaatcctggaatagccttagctgttactgtcctcacaacaggattttgg
ccaagttacaaatcttttgatataaatctacctgcagaaatggtgaaatgtgtagaggtt
ttcaaggagttttaccaaacaagaacaaaacacaggaaacttacctggatttattcactg
ggaacctgtaatattaatgctaaatttgaggccaaaactattgagctcattgttacaact
tatcaggctgcattgctgctgctgtttaatggagttgatagactcagctattctgagatt
gtgacacagttaaatctctcagatgatgatgttgttcgattgctccattctctatcttgt
gcaaaatacaagattcttagcaaagaaccaaataatagatctatttcaccaaatgatgtc
ttcgagttcaactcaaagtttactgacaagctgcgaagattaaagatacctcttcctcca
gttgatgagaagaagaaagtagttgaagatgttgataaggatcgcagatacgcaattgat
gcatcaattgtgcgtattatgaagagtcgcaaagtattgggtcatcagcaacttgtgatg
gaatgtgtggagcagcttggacgcatgtttaagcctgacttcaaggcaataaagaagcga
attgaggatcttatcacaagggattacttggagagggataaagacaacccaaatgtgtac
agatacttggcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325736
Entry
4325736           CDS       T01015                                 
Name
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4325736
   04120 Ubiquitin mediated proteolysis
    4325736
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4325736
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     4325736
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 4325736
NCBI-ProteinID: XP_015622492
UniProt: Q93VL5 Q7F5P3
LinkDB
Position
1:15146079..15152324
AA seq 746 aa
MNMSPRIPVVDLEDGWRDVLAGVAKLKCILDGSNVVHFVPDEYMHLYTTVYNMCTQKPPN
DYSQVLYDRYKQALDDHIESVVLPSLNEKHGVFLLREIVQRWEKHKLMVRWLRRFFDYLD
RYYVTRRSLDSLKDLGWSSFRDLVFDKLKSTVATIMIGMIDDEREGNLIDRPLLKNALDI
YVEIGDSQLNYYSDDFEQSFLNGTTDYYSKKAQTWILENSCPEYMLKAEECLQKEKDRVA
NYLHSTTEPKLFAAALFELIDRRAEEILNKENSGCKVLLCDEKTEDLARMFRLFSRITDG
LLPVSKIFKEHVIAEGMSLLKHATDAANSRKDEKKGVVVGLPEQDFVRSVIELHDKYMAY
VTNCFQSNSVFHKALKEAFEVICNKDVVGCSSAELFAAYCDSILKRGGSEKLSDEAIDES
LEKVVKLLTYLSDKDLFVEFHRKKLGRRLLFDKNTNDEHERILLSKLKQFFGGQFTSKME
GMLKDITLAKEHQSSFEEYVSNNPESNPLIDLNVTVLTTGYWPTYKNSDINLPLEMVKCV
EVFKEYYRSDKQHRKLTWIFSLGNCVVIGNFDAKPVEFVLNTYQAALLLLFNEADKLSYS
DIVSQLKLSDDDAVRLLHSLSCAKYKILNKEPSNRVISPEDEFEFNSKFTDRMRRIKVPL
PQIDEKKKVVDDVNKDRRFAIDASLVRIMKSRKVLGHQQLVAECVEQLSRMFKPDIKIIK
RRIEDLISREYLERDSENAQTYKYLA
NT seq 2241 nt   +upstreamnt  +downstreamnt
atgaatatgtcgccgcgcattccggtggtggacctcgaggacgggtggcgcgacgtgctc
gccggcgtcgccaagctcaagtgcatcctcgatggctccaacgtcgtgcacttcgtcccc
gacgagtacatgcacctctacacgacggtttacaacatgtgcacgcagaagccgccgaac
gactactcgcaggtgctctacgatcgctacaagcaggccctggacgatcacatcgaatcc
gtcgtgttgccctccttgaatgagaagcatggcgtgttccttctgagggaaatagtgcag
aggtgggagaaacacaagctaatggtaaggtggctgaggaggttctttgactacctcgat
cgttactatgttacacggaggtcccttgattcactcaaagatctgggctggagtagcttc
cgggatttggttttcgataagctcaaaagtactgtggcaacaattatgattggcatgatt
gatgatgagagggaaggcaatctaatagaccgtccactcctgaagaatgcccttgatatc
tatgttgaaattggggatagtcaactgaattattacagtgatgattttgaacaatcattt
ctcaacggaacaacagattactattctaagaaggcacaaacatggattcttgagaattct
tgccctgaatacatgctcaaggctgaggaatgcttacaaaaagagaaagaccgggttgca
aattacttgcattctactacagaaccaaagctatttgcggctgcactcttcgagttgata
gataggcgtgcagaagaaattctgaacaaggagaactccggatgcaaagtgttgctttgt
gatgaaaagaccgaggatctagcaaggatgtttaggctcttctctaggataactgacggg
ctgcttccagtatcgaaaatatttaaggagcatgtcattgctgagggtatgtctctgctg
aaacatgcaacagatgctgccaacagcagaaaggatgagaagaagggggtggtggtggga
ttgccggagcaggattttgtgaggagtgtcatagagctccatgacaaatatatggcatat
gtcaccaactgtttccagagcaactcagtatttcacaaggcacttaaggaggcctttgaa
gttatttgcaacaaagatgttgttggttgcagtagtgctgaactgtttgcggcatactgt
gatagtatcttaaaaagaggtggaagtgaaaagctaagtgatgaagctatagatgaaagt
cttgagaaggttgtcaagcttctaacatatctcagcgacaaggacctctttgtagagttt
cataggaagaaacttggaaggagattgctgtttgataagaatacaaatgacgaacatgag
agaatcctactctccaagctgaagcaattcttcgggggacagtttacatcaaaaatggag
gggatgctcaaagatattacattggcaaaagaacatcagtcaagttttgaggagtacgta
agcaacaatccagagtcaaatcctctgatagacttgaatgtgactgtcttgacaacagga
tactggccaacatacaagaactcagatataaatcttccattggagatggttaaatgcgtg
gaggttttcaaggaatattatcggtccgacaagcaacacagaaagcttacctggatcttt
tccttgggaaactgcgtcgtcattggaaattttgatgctaaacctgttgagttcgttctc
aacacttatcaggctgcattgttgctgctattcaatgaagctgataaactgagttactct
gatattgtgtcacaattaaaactgtctgatgatgatgccgtgcgtttgcttcattcgctt
tcttgtgcaaagtataagattctcaacaaagagcctagcaacagagtgatttctccagag
gacgagtttgagttcaattccaaatttaccgataggatgcgaaggattaaggtaccactt
cctcaaatcgatgagaagaaaaaggttgtcgatgatgtcaacaaggacaggaggttcgca
attgatgcatctcttgtgcgcatcatgaaaagccgcaaagttctgggccatcagcaactt
gtagcggaatgcgtggagcagctcagccgcatgtttaagcctgacatcaagatcatcaag
aggaggatcgaggatcttatcagcagggagtacttggagcgtgattcggagaatgcccag
acctacaaatacttggcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337820
Entry
4337820           CDS       T01015                                 
Name
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4337820
   04120 Ubiquitin mediated proteolysis
    4337820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4337820
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     4337820
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 4337820
NCBI-ProteinID: XP_015639865
UniProt: B9FHD6
LinkDB
Position
5:complement(2834181..2840844)
AA seq 744 aa
MAGQERRTIDLEEGWAFMQKGITKLKNILEGKPEPQFSSEDYMMLYTTIYNMCTQKPPHD
YSQQLYDKYRESFEEYITSMVLPSLRDKHDEFMLRELVKRWSNHKIMVRWLSRFFFYLDR
YFISRRSLIPLEQVGLTCFRDLIYQEIKGQVKGAVIALIDKEREGEQIDRALLKNVLGIF
VEIGLGSMECYENDFEDFLLKDTTDYYSLKAQSWILEDSCPDYMIKAEECLKKEKERVGH
YLHISSEQKLLEKVQNELLAQYATPLLEKEHSGCFALLRDDKEEDLSRMYRLFSKINRGL
EPIANMFKTHVTNEGTALVKQAEDSASNKKPEKKDMVGMQEQVFVWKIIELHDKYVAYVT
ECFQGHTLFHKALKEAFEVFCNKGVSGSSSAELLATFCDNILKKGCSEKLSDEAIEDALE
KVVRLLAYISDKDLFAEFYRKKLARRLLFDKSANDEHERSILTKLKQQCGGQFTSKMEGM
VTDLTVARDHQTKFEEFVAAHQELNPGIDLAVTVLTTGFWPSYKTFDINLPAEMVKCVEV
FKEFYQTRTKHRKLTWIYSLGTCNINAKFEAKTIELIVTTYQAALLLLFNGSDRLTYSEI
VTQLNLSDDDVVRLLHSLSCAKYKILNKEPANRSISPNDVFEFNSKFTDRMRRIKIPLPP
VDEKKKVVEDVDKDRRYAIDASIVRIMKSRKVMGHQQLVAECVEQLSRMFKPDFKAIKKR
IEDLITRDYLEREKDNANVYRYLA
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggcggggcaggagcggaggacgatcgatctggaggagggatgggcgttcatgcagaag
ggcatcaccaagctgaagaacatcctcgagggcaagcccgagccacagttcagctccgag
gactacatgatgctctacacgacgatatacaacatgtgcacgcagaagccgccgcacgac
tactcgcagcagctctacgacaagtaccgggagtcattcgaggagtacatcacctccatg
gtcttaccttcattaagagataaacatgacgagtttatgctgagggaactagtaaagagg
tggtcaaaccataaaatcatggttcggtggctgtcacgtttcttcttttatcttgatcga
tacttcatctcacggaggtcgcttataccacttgaacaagttgggcttacttgcttccga
gatttgatataccaagaaatcaaaggacaagttaaaggtgcagtgatagctctgattgac
aaagagcgtgaaggcgaacagatagacagggccctgctgaagaatgtcctgggcatattt
gttgaaattggactaggcagtatggaatgttatgagaatgactttgaagatttcttgctt
aaggatactacagattactactctctcaaggctcaaagctggattctcgaggactcttgt
cctgattacatgataaaggctgaggagtgcttgaagaaagagaaggagcgagttggtcac
tacttgcatattagtagtgaacagaagttactggagaaagtgcaaaatgaattgcttgca
caatatgcaactcccctgttggagaaggagcattctgggtgttttgcattgcttcgtgat
gacaaggaggaagacctttctaggatgtacaggctcttctccaaaattaaccgcggtcta
gaacctattgctaacatgtttaaaacgcatgttacaaatgagggcacagccttggtcaag
caagcagaagattctgctagtaataagaagcccgagaaaaaggacatggttggtatgcag
gaacaggtttttgtctggaaaatcattgagctccatgacaagtatgtagcttatgtcaca
gaatgtttccagggtcacaccctctttcataaggcccttaaagaagcattcgaggtcttc
tgtaacaagggtgtctctggcagttcaagtgctgaactgcttgccaccttctgtgacaat
attctgaagaaaggttgcagtgaaaagctcagtgatgaagccatcgaagatgctcttgag
aaggtggtgcgattgcttgcatacatcagcgataaagacctctttgctgagttttacagg
aaaaaacttgcaaggagattgctttttgataagagtgccaatgatgaacatgaaagaagc
atacttaccaaactcaagcagcagtgtggtggacaatttacttctaaaatggagggaatg
gttactgatcttactgttgcaagggaccatcaaactaagtttgaagagtttgtggctgca
catcaggagttgaatcctgggatagacttggctgtcactgttttgacaacaggattctgg
ccaagttacaagactttcgatattaaccttcctgctgagatggtgaaatgcgtggaggtt
ttcaaggagttttaccaaacaagaacaaaacacagaaagcttacctggatatattccttg
ggaacctgcaatatcaatgcaaagtttgaggcaaaaactattgagctcattgtcacaaca
tatcaggctgcgttgctgctgctattcaacggatctgacaggcttacttattctgagatt
gtaacacagctaaacttatcagatgatgatgtagtgcgtttgctccattctctctcctgt
gcaaaatacaagattcttaacaaggaaccagctaatagatctatttctcccaacgatgtt
tttgagttcaattcaaaattcactgacaggatgagaagaattaagatacccctacctcct
gttgatgaaaagaaaaaggttgtcgaagatgttgacaaggacaggcggtatgcaattgat
gcatcgattgtgcgcattatgaagagtcgcaaagttatgggccatcagcagctagttgcg
gaatgtgtggagcagctcagccgcatgttcaagcctgacttcaaagccatcaagaagcga
atcgaggacctcatcacaagggattacctggaacgcgagaaggacaacgctaatgtgtac
agatacctggcttga

DBGET integrated database retrieval system