KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325738
Entry
4325738           CDS       T01015                                 
Name
(RefSeq) probable ADP-ribosylation factor GTPase-activating protein AGD11
  KO
K12486  stromal membrane-associated protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4325738
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4325738
Membrane trafficking [BR:osa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    4325738
 Endosome - Golgi transport
   Arf GTPase associated proteins
    4325738
SSDB
Motif
Pfam: ArfGap C2
Other DBs
NCBI-GeneID: 4325738
NCBI-ProteinID: XP_015628511
UniProt: Q0JG03
LinkDB
Position
1:41882476..41886246
AA seq 381 aa
MEGHKPVHQFVDSPKPQRSARRICGMASRIDANDHGNQQGGNPQGPVGTAERLEHLLNQP
ANKICADCGAPDPKWVSLTFGVFICIKCSGAHRSLGVHISKVVSVKLDEWTDEQVDILAD
SGGNAAVNMIYEAFIPENYMKPRQDCSSEGRNDFVRRKYELQQFLSNTQLTCYSQKSGKN
HNRVQHSSSNRHGLGHAFRNSWRRKEHESKSVKKTVEIGMVEFVGLIKVNVIRGTNLAVR
DMMSSDPYVILNLGHQSMKTKVIKSSLNPVWNERILLSIPDPIPMLKLQVYDKDTFTTDD
RMGEAEINIQPLVAAAKAYETSVVADTAQLNRWLAKEGIWIQKDSAISIIDGKVKQEVTV
RLQNVERGHLEMELECVPLTQ
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggaggggcacaaaccagtgcaccaattcgttgatagccccaagccgcagcgcagcgcg
aggagaatttgtggaatggcatcgaggatcgatgcgaatgaccacggcaatcagcaagga
ggcaatccccaaggtccagttggtacagcagagagattagagcatcttttaaaccaacca
gcaaacaaaatttgtgctgactgtggtgctccagatcccaaatgggtgtcattgactttt
ggtgtgtttatttgcatcaagtgctctggagctcatagaagtcttggggtgcacatatcc
aaggtggtctcagtaaagctagacgagtggacagatgaacaagttgatattttagctgat
tcaggtggaaatgctgcagttaacatgatatacgaggcgtttatacctgaaaactacatg
aagccaaggcaagattgctcatcagaggggcgcaatgactttgttaggagaaaatatgag
cttcaacaatttttgtccaacacacagcttacttgctactcacaaaagagcggaaaaaat
cataatcgcgtacaacatagcagttcaaataggcatggtttaggccatgctttcaggaac
agttggaggagaaaagaacatgagagtaaatcagtgaagaaaacagtggagataggtatg
gttgaatttgttggattaattaaggtcaatgtcataagaggcacaaatctagctgttcgt
gatatgatgtccagcgacccttatgttatccttaaccttggacaccagtcgatgaaaaca
aaggtgattaagagcagcctgaatcctgtatggaatgaaaggattttgctatcaatacct
gatcccatacctatgcttaaattgcaagtctatgacaaggacacattcactacagacgac
cgaatgggggaggctgagattaacattcagccactggttgctgcagccaaggcatatgag
acctcggtcgtcgctgatacggcacagctcaacagatggctagcaaaagaaggcatctgg
atccaaaaggacagtgctatctccatcatcgatggcaaggtgaagcaggaggtgaccgtc
aggcttcagaacgtcgagcgtggccatcttgagatggagctcgagtgtgtcccgctcacg
caatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328629
Entry
4328629           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor GTPase-activating protein AGD12
  KO
K12486  stromal membrane-associated protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4328629
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328629
Membrane trafficking [BR:osa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    4328629
 Endosome - Golgi transport
   Arf GTPase associated proteins
    4328629
SSDB
Motif
Pfam: ArfGap C2 DOCK-C2
Other DBs
NCBI-GeneID: 4328629
NCBI-ProteinID: XP_015622975
UniProt: A0A0P0VFY5 Q6H738
LinkDB
Position
2:5505041..5508422
AA seq 320 aa
MSGRRDDSAKMAKLKELLHRSENRICADCSAPDPKWASANIGVFICLKCSGVHRSLGTHI
SKVLSVTLDQWSDNEIDNVIEVGGNSHANAIYETFLPQNHSKPHPDSTQEEREKFIRSKY
ELQEFLEPSLRIVSHQSSDSGKHAGSASHSVSSKSEVGMIEFIGILNVKVKGGTNLAIRD
MSSSDPYVVLTLGQQKAQTSVIKANLNPVWNEELKLSVPQQYGPLKLQVFDHDMLSKDDL
MGEAEIDLQPMINAAAAFGDPGLLGDRQIGRWLKSGDNALVRDSAVVVAGGEVRQELALK
LQFTESGEVELEMQWFPLNM
NT seq 963 nt   +upstreamnt  +downstreamnt
atgagtggaagacgtgatgattcagctaagatggcaaaactgaaggagctattgcacaga
agtgaaaaccgtatctgtgctgactgcagcgcgcctgaccccaaatgggcatcagctaat
ataggagtattcatatgcctcaagtgttccggtgttcacagaagtcttggcacacacatt
tcaaaggttctgtcagtcacactagatcagtggagtgacaatgaaattgataacgtgatc
gaagtcggtggaaattctcacgccaatgctatatatgaaaccttcctgccgcagaaccac
agcaagccacatccagattctacccaggaagagcgagaaaaattcatcaggtcaaaatat
gagttacaagagtttcttgagccaagcctacggattgtttctcatcagtctagcgactcc
gggaaacatgcaggcagtgcctcccattctgtcagttccaagagcgaagtaggcatgatt
gagttcatcggaatattgaatgtcaaggtgaaaggaggcaccaacctagccatcagagac
atgtcaagcagtgatccttatgtagtcctgacccttgggcaacagaaagcgcaaacctcg
gtgatcaaagccaacctgaaccctgtctggaacgaagaactcaagctctctgttcctcag
caatacggccctctcaaactgcaagtgttcgaccacgacatgctgtccaaggacgacctg
atgggggaggccgagatcgacctgcagccgatgatcaacgcggcggcggcgttcggcgac
ccggggctgctcggcgaccggcagatcggccggtggctcaagtccggcgacaacgcgctc
gtcagggacagcgccgtcgtggtcgccggcggcgaggtgaggcaggagctggccctcaag
ctgcagttcaccgagtccggcgaggtggagctggagatgcagtggtttccactcaacatg
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330061
Entry
4330061           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor GTPase-activating protein AGD2
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4330061
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4330061
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4330061
Membrane trafficking [BR:osa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    4330061
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    4330061
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4330061
SSDB
Motif
Pfam: BAR_3 ArfGap BAR Ank_5 PH Ank Ank_3 Ank_2 Ank_4 PH_11 PH_8 PH_20 BAR_2
Other DBs
NCBI-GeneID: 4330061
NCBI-ProteinID: XP_015625922
UniProt: Q0DZC1 Q6H462
LinkDB
Position
2:25329175..25341942
AA seq 760 aa
MAAFTKLEDSPMFRKQVNSMEQLSDELKQRCSNLHKGCKRFMGSLDEGYAGDLTFADALE
AFGAGQDDPVSVAIGGPVMSKFTTAFRELGTYKELLRSQVDHMLSERLMQFIDVDLHGVK
DCRQRLDRATVGYDQAREKFVSVRKGTRAEVVTGLEEDLHNAKSAFERCRFNLVHALSNI
EAKKKYEFLESISAVMDAHLRYFKQGYELLSQMEPFIHQVLTYAQQSKEMAINEQDKLAK
RIQEYRTQEEIANLRMASNVDTSTSGDGIHVVGLQSYKKIEALMQSTANGEVQIIKQGYL
FKRSENSREWKRRFFVLDSHGTLFYYGNKGQSQGAASQQTAGEGTGVFSRFRFLNQKAPT
QGDNALSCHKIDLRTSTIKIDAEENDLRFCFRVISPMKAYTLQAESGADQKDWIEKVTGV
IASLLNLPFPRQVSYGNLEAEHHGSANSVDSLSLEENKSPEGHDDIFNHLRNIPGNDSCA
ECRSPDPDWASLNLGILICIECSGAHRNLGVHISKVRSLRLDVKVWEPVIMDLFHELGND
YTNSIWEAMLPKEDQGINEFNDAILFIEKPKPTDAFSIKERYIQTKYVDKLLIAKDTNQI
TIDILEAVRTNDVRAAYRILVLADVSPNMIYDELNNDVHHDPSVTDGKLFDPASCDVKDD
SGKPEGCLQGCSLLHIACQYGHSIMAELLLLFGADINKQDFHGRTPLHHCVRRKNDALTK
HLLKRGARTTIKDGGGLTALERRMELGAITDEDLFILFVR
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcggccttcaccaagctcgaggactcccccatgttccgcaagcaggtcaattctatg
gaacagctaagcgatgaactgaaacaacggtgttcaaatcttcataaaggatgcaaaaga
ttcatgggatcacttgatgaaggatacgcgggagatctaacatttgccgatgctctagaa
gcatttggtgctggtcaagatgatcctgttagtgttgccattggagggcctgtaatgtcc
aagttcactactgcttttagggagcttggaacatacaaggaactccttcgttctcaggtt
gatcatatgcttagtgaacgtttgatgcaattcattgatgtggatttgcatggcgtgaag
gattgtcgtcagcgtttggatagggctacagtggggtatgatcaggcacgtgaaaaattt
gtatcagtacggaaagggactagagcagaagtagtgacaggacttgaggaggatctacac
aatgccaagtcagctttcgaacgatgccgctttaacctagtgcacgcactttcaaatatt
gaagcaaagaagaagtatgagttcttggaatcaataagtgcagtgatggatgcccatttg
agatatttcaagcagggatatgaactactgagtcaaatggaaccattcattcaccaggtt
ctaacatatgcacagcaatcaaaagaaatggctatcaatgaacaagataaacttgcaaag
agaattcaagaatataggactcaagaggaaattgcgaacttgagaatggctagtaatgtg
gacacatctaccagtggtgatggtatccatgttgttggtcttcaatcctataaaaagatt
gaagccctaatgcagtcaactgccaatggcgaggttcaaataatcaaacaaggttatctc
tttaagcgttctgaaaattcacgagaatggaagagaaggttctttgttctcgacagtcac
gggactcttttctactacgggaataaaggacaatcgcaaggagcggcatcacagcaaaca
gctggtgaagggactggtgtttttagtcgtttcagattcttgaaccaaaaggctccaact
cagggtgacaatgcactttcgtgccacaaaattgatctaagaacttcaacaattaagatt
gatgcagaagaaaatgacctaagattttgcttcagagtaatctctcccatgaaagcatac
actttacaggcagaatctggtgctgaccaaaaggattggattgagaaagttactggagtt
attgcatcactgcttaatttaccattcccaagacaggtgtcgtatggaaatctagaggcg
gaacatcatggttctgcaaattctgttgattctctctctcttgaggagaacaaaagtcca
gagggacatgatgatatattcaatcatctcaggaatattcctggaaatgacagttgtgca
gaatgtcgttcaccggatcctgattgggcatctctaaatttaggaattcttatttgtata
gagtgttctggggctcacaggaatcttggagtccatatttcgaaggttcgatccttgcga
ttagatgtcaaggtatgggagccagtgataatggacttgttccatgaacttggaaatgac
tacactaattccatttgggaagctatgcttccgaaagaagatcaaggaataaacgagttt
aatgatgctattcttttcattgaaaagcctaaacctactgatgctttttcaataaaggaa
aggtacatacagacaaagtatgtcgacaagcttcttattgccaaagataccaatcaaatt
accattgatatattggaggctgtaaggacgaatgatgtgagggcagcatatcgcattctt
gtgttggctgatgtgagccctaacatgatatatgatgagttaaacaatgatgttcatcat
gatccttcagtaacagatgggaagttatttgatccagcatcttgtgatgtaaaggatgat
tctgggaaaccagaaggttgtctacaaggctgttccctgttgcacattgcttgccaatat
ggccattctataatggcagagcttctgcttctttttggtgcggatattaataagcaagac
ttccatggacggacaccgttgcaccattgtgtccgaaggaaaaatgatgcacttaccaag
catctgctaaagaggggtgcaagaacaaccattaaagatggtggagggttgactgcttta
gagagaagaatggaacttggagcaataactgatgaagatttgttcattttatttgtaagg
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330565
Entry
4330565           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor GTPase-activating protein AGD12
  KO
K12486  stromal membrane-associated protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4330565
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4330565
Membrane trafficking [BR:osa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    4330565
 Endosome - Golgi transport
   Arf GTPase associated proteins
    4330565
SSDB
Motif
Pfam: ArfGap C2
Other DBs
NCBI-GeneID: 4330565
NCBI-ProteinID: XP_015626849
UniProt: Q6Z653 Q0DY07
LinkDB
Position
2:complement(29998301..30002808)
AA seq 332 aa
MSTTNHYQHIKSNKPVLGKARKLKDLMLKSDNRICADCGAPDPKWASANIGVFLCLKCGD
VHRALGPDVSKVLSVTLDDWSDSDIDSMLEIGGNSYANSIYESFLPKDHPKPKMDSTMEY
RTKFIRAKYETQDFLKPSLRITSKGSFDATNAVKSVTSSISSASGKHVADDTREFVGELN
ITVVRGIQLAVRDMLTSDPYVVLTLGEQKAQTTVKPSDLNPVWNEVLKISIPRNYGPLKL
EVYDHDTFSADDIMGEAEIDLQPMITAVMAFGDPSRVGDMQIGRWFMTKDNALVKDSTVN
VVSGKVKQEVHLKLQNVESGEMELELEWVPIP
NT seq 999 nt   +upstreamnt  +downstreamnt
atgagtaccactaatcactatcaacacatcaagtcaaacaagcctgttctaggcaaagca
agaaaattgaaggatctaatgttaaaaagtgacaaccggatatgtgctgattgtggtgca
cctgatcccaaatgggcgtctgctaatatcggagtatttctttgcttaaagtgtggagat
gtacatagagcacttggaccagacgtttcaaaggttttgtcagtaactctggatgattgg
tctgatagtgatatagattccatgcttgagattggtggaaactcatatgcaaattccatt
tatgagtcttttcttccaaaagatcacccaaaacccaagatggattcaactatggaatat
aggactaaatttataagagccaagtatgagacacaagattttttgaagccaagtttgcgc
attacatcaaagggttcttttgatgcgaccaatgctgtgaagagtgtaactagcagtatc
tctagcgcttcagggaagcatgtcgctgacgatacaagagaatttgttggagagctgaac
attacagtggtaagaggtattcagttggccgtcagagacatgctaacgagcgatccatat
gttgttctaacacttggggagcagaaagctcaaaccactgttaaaccgagtgacttgaac
ccagtatggaatgaggtgcttaagatatcaattcctcgaaattatggacctcttaaactt
gaagtatacgaccatgatacgttctctgctgatgatatcatgggggaagcggagatagat
cttcaaccaatgatcacagccgtcatggcctttggagatccctcgcgtgttggtgacatg
caaattggaaggtggttcatgaccaaagacaatgccctggtgaaagatagcactgtcaat
gttgtgtcgggcaaggtaaaacaggaagtgcacctaaagttgcagaatgtagaatcaggt
gagatggagttagaactggaatgggttccaataccctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332427
Entry
4332427           CDS       T01015                                 
Name
(RefSeq) probable ADP-ribosylation factor GTPase-activating protein AGD6
  KO
K12492  ADP-ribosylation factor GTPase-activating protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4332427
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4332427
Membrane trafficking [BR:osa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    4332427
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 4332427
NCBI-ProteinID: XP_015632454
UniProt: A0A8J8XGN0 Q10N88
LinkDB
Position
3:complement(9455711..9458949)
AA seq 453 aa
MASTAARRLRELQGQAGNKTCVDCAQRNPQWASVSYGVFMCLECSGKHRGLGVHISFVRS
VTMDSWTEAQLRKMEAGGNDRLNAFLAARGVPKETPHVAKYNSNAAAAYRDRIVAVAEGR
PWTDPPVVKETPGSGAPAPTRKPPLPAGGGGGGGGGWDDWDDDFRPDMRRNQSVGSFGES
GAESGRQPPRSKSTQDMYTRQQLEASAANKDSFFARRMAENESKPEGIPPSQGGKYVGFG
SSPAPSANRNGAAAQGDVMQVVSQGIGRLSLVAASAAQSAASVVQVGTKEFQSKMREGGY
DQKVNETVNVVANKTAEIGSRTWGIMKGVMALASQKVEEYAKEGGNGWGDDWQRREQGSE
PYHRFERETNGNGWNSSSHDGSSKNYNSNSWDDWDEPVKKDEPAKERQSSDSWAGWDDGK
DDNFDSYNHSTPSKGSNQNGTTGGSYWTEGGFR
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcgtcgacggcggcgaggcggctacgggagctgcaggggcaggcggggaacaagacg
tgcgtggactgcgcgcagcggaacccgcagtgggcgagcgtctcgtacggggtgttcatg
tgcctcgagtgctcgggcaagcaccgggggctcggcgtgcacatcagcttcgtccgctcc
gtcaccatggactcgtggaccgaggcgcagctccgcaagatggaggccggcggcaacgac
cgcctcaacgccttcctcgccgcgcggggcgtgcccaaggagaccccccacgtcgccaag
tacaactccaacgccgccgccgcgtaccgcgaccgcatcgtcgccgtcgccgagggccgc
ccgtggaccgacccgcccgtcgtgaaggagacccccggatctggcgcgcccgcccccacc
aggaagccacccttgcccgccggaggcggcggcggcggcggcggcggatgggatgactgg
gacgacgatttccggcccgacatgaggaggaaccagtcggtggggtcgttcggtgagtcg
ggggcggaatcagggaggcagccgccgaggtccaaatcgacgcaggacatgtacacgagg
cagcagctggaggcgtcggcggccaacaaggacagcttcttcgccaggaggatggcggag
aacgagtcgaagcccgaggggatcccgccctcgcagggtgggaaatacgtcgggttcggc
tccagcccggcgccgtcggcgaatcggaacggcgctgctgctcagggtgatgtcatgcag
gtcgtctcccagggaattggacggctttcactagttgcagcatctgctgcccagtctgct
gccagtgttgtccaagttggcacaaaagagttccaatcaaagatgagggaagggggctat
gatcagaaggtgaatgaaactgtaaatgttgttgccaataaaaccgcagagattggaagt
agaacatggggaattatgaaaggggtaatggcgttagcgtcacaaaaggttgaggagtat
gccaaggaaggtgggaatggctggggggatgattggcaacgcagggagcagggcagtgag
ccttaccataggtttgagcgtgagaccaatggtaatgggtggaattcttcttctcatgat
ggttcatcaaagaattacaattccaattcctgggatgattgggatgagccagtcaagaag
gatgagcctgcgaaagaacgccaaagcagtgactcctgggccggctgggatgatgggaag
gatgacaattttgatagttacaatcacagcacccccagcaaggggagcaatcagaacgga
accaccggtggctcctattggacggaaggcggcttccgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334823
Entry
4334823           CDS       T01015                                 
Name
(RefSeq) probable ADP-ribosylation factor GTPase-activating protein AGD9
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334823
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334823
Membrane trafficking [BR:osa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    4334823
SSDB
Motif
Pfam: ArfGap DUF6668
Other DBs
NCBI-GeneID: 4334823
NCBI-ProteinID: XP_015630423
UniProt: Q0DLN9 Q84T71
LinkDB
Position
3:complement(35975442..35978908)
AA seq 412 aa
MAFDAFTDKNAVFRRLKAKPENKMCFDCSAKNPTWASVTYGIFLCLDCSAVHRSLGVHIT
FVRSTNLDSWTPDQLKMMAFGGNNRAHAFFKQHGWTDGGKVDAKYTSRAAELYRQILQKE
VAKSSADNVLPSSPVAASQPQNPSDDFPEFKLPEAPAENTNGKQEPDVTNSQKAPTQTPK
APTHPTFATSVKKSIGAKKIGGKTGGLGVKKLTTKPSESLYDQKPEEPKPAAPVMTTSTT
KSGPSLHSRFEYVENEPAVDSRNGGTQMTGHVAPPKSSNFFQEYGMDNGFQKKTSTAATK
TQIQETDEARKKFSNAKAISSSQFFGNQSREEKDAQMSLQKFAGSSSISSADLFGRRDMD
DSNLDLSAADLINRISFQASQDLSSLKNMAGETGKKLTSIASNFISDLDRIL
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcgttcgacgccttcaccgacaagaacgccgtcttccgccgcctcaaggccaagccc
gagaacaagatgtgcttcgactgcagcgccaagaaccccacctgggcctccgtcacctac
ggcatcttcctctgcctcgactgctccgccgtccaccgcagcctcggcgtccacatcacc
ttcgtcaggtcaacaaacctagattcatggactccagatcaactgaagatgatggctttt
ggaggcaacaatcgtgcccatgctttctttaaacagcacgggtggacagatggtggcaag
gtcgacgcaaagtacacgtcaagggctgctgagctgtacaggcagatactgcaaaaggaa
gttgccaagagttctgctgataacgtcttgccatcgtcgccagttgcagcgtctcaacca
caaaatccatccgatgacttccctgagttcaagctaccagaggcaccagcagagaatacc
aatgggaagcaggaacctgatgtcaccaattcgcaaaaagcacctacgcagacaccaaaa
gcccctactcatcccacttttgccacttctgtaaagaagtccattggtgcgaagaagatt
ggaggcaagactggagggcttggtgttaaaaagctcaccacaaagccaagtgaaagcctg
tatgatcagaaacctgaagagccaaaacctgctgccccagtaatgactacttccaccaca
aaaagtggcccgtccttgcattcacgttttgaatatgtggagaatgagccagcagttgat
tcaagaaatggaggaactcaaatgactggccacgtagcaccaccaaaatcatcaaacttc
tttcaagagtacggaatggataatgggttccaaaagaaaacaagcacagctgccacaaag
acccagattcaggagactgacgaagcaaggaaaaaattctctaatgcaaaggcaatttca
tcatctcagttttttggcaatcaaagcagagaagagaaagacgctcaaatgtcccttcaa
aagtttgcgggttcttcgtccatttcaagtgctgatctttttggccgccgcgacatggat
gactcgaatctggatttaagtgctgcggatctcatcaacagaatatcattccaggcatct
caagatctgtcttccctcaagaatatggctggagaaactggaaagaagctgacatctata
gcctccaattttatcagcgacctcgacagaatcctttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338640
Entry
4338640           CDS       T01015                                 
Name
(RefSeq) probable ADP-ribosylation factor GTPase-activating protein AGD11
  KO
K12486  stromal membrane-associated protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4338640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4338640
Membrane trafficking [BR:osa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    4338640
 Endosome - Golgi transport
   Arf GTPase associated proteins
    4338640
SSDB
Motif
Pfam: ArfGap C2 DZR
Other DBs
NCBI-GeneID: 4338640
NCBI-ProteinID: XP_015638885
UniProt: Q6L4C8 Q0DIK6
LinkDB
Position
5:18466852..18470665
AA seq 395 aa
MHRQDVRTKEAEEERMEENNLLHFLDSPNAHYRRKCEEYVSAHDDEAHCDASDVDLANAR
ERLEHLLKQPANKFCADCGTPDPKWAALPFGALICIKCSGTHRSLGVHISKVISVNLDEW
TDEEVNCLAGSGGNATVNTRYEAFLPENFKKPRHDCTTEERCNFIRKKYEFQQFVTDPQF
SCPLRLNTKHAPDKNQQQQNCSARHGFGHAFRNSWKRKDTDNKGLKKMTDVGMVEFVGLI
KVDIRRGTNLAVRDVMSSDPYVMLNLGHQTMKTKVIKNTLNPVWNERLMLSIPHPVPPLK
LQVFDKDTFSSDDRMGDVEVDIQPLIAAAREHESSAAIAGSVEVTKLLASDDGTLARDSV
ISVVDGKVKQDIALRLQNVEHGELEIELECVPLSQ
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcatcgccaggacgtgaggacgaaggaggccgaggaggagaggatggaggagaacaat
ctcctgcattttctagatagcccaaacgcgcattacagaaggaaatgtgaagaatacgta
tccgcgcatgatgatgaagcccattgcgatgcatcagatgtagatctggccaatgcaagg
gaaagattggagcatctgttgaaacaacctgccaacaagttctgtgcagactgtggtacc
cctgatccaaaatgggcggccttgccttttggtgcgttgatttgcataaagtgctctgga
actcatagaagtcttggagtacacatatcaaaggtaatttccgtgaatctagacgaatgg
acagatgaagaggtcaattgtttagctggttcaggtggaaatgctacggtgaacacaaga
tatgaggcctttttgccagagaactttaaaaagcccagacatgattgcacaacagaggag
cgttgcaatttcattaggaaaaagtacgagtttcaacagtttgtgactgatccacagttt
tcatgccctttacgattgaataccaaacacgcaccagacaagaatcagcagcagcaaaac
tgcagtgcgcgacatggttttggccatgcttttaggaatagctggaagagaaaggacaca
gataacaaaggactaaagaaaatgacggatgtgggtatggtggaatttgttggattaatt
aaggttgatattagacggggcacaaatcttgctgttcgtgatgtgatgtcaagtgatcca
tatgttatgcttaacctaggacaccaaaccatgaaaacgaaggtgataaagaacaccctg
aatcctgtatggaatgaaagactaatgctatcgatccctcacccggtgccgcctcttaaa
ttgcaagtgttcgacaaggacacgttcagctccgacgaccggatgggcgatgtggaggtg
gacatccagccgctgatcgccgcggcgcgagaacacgagagctcggccgccatcgccggc
tcggtggaggtcacgaagctgctggcgagcgacgacggcacgctggccagggacagcgtc
atctccgtcgtcgacggcaaggtgaagcaggacatcgcgctgaggctccagaacgtggag
cacggggagctggagatcgagctcgagtgcgtgccgctcagccagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343612
Entry
4343612           CDS       T01015                                 
Name
(RefSeq) probable ADP-ribosylation factor GTPase-activating protein AGD5
  KO
K12486  stromal membrane-associated protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4343612
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4343612
Membrane trafficking [BR:osa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    4343612
 Endosome - Golgi transport
   Arf GTPase associated proteins
    4343612
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 4343612
NCBI-ProteinID: XP_015647262
UniProt: Q69QY4 A3BL67
LinkDB
Position
7:complement(22572138..22577898)
AA seq 476 aa
MNEKASVSKELNAKHKKILEGLLRLPENRECADCKSKGPRWASVNLGIFICMQCSGIHRS
LGVHISKVRSATLDTWLPEQVAFIQSMGNEKSNSYWEAELPPNYDRVGIENFIRAKYEDK
RWIPRNGSSRPSSGARDEKSSESQTSVNRGGHNQRSSFEQHRTSPAAVSKIAPVVSRTPT
QAPHQPKAQPSVPKVSPPQPEKSPPNATPPKVERPSVAPPPKVDYATDLFNMLSMDGTTE
KEAESSSNDDSAWEGFQSAEPVPSSDKKDSAKPVESKPQSTSGIEDLFKDSPAVTVSSAP
AAPQVNVKNDIMSLFEKSSMVSPYAVQQQQLAFMTPQQLALLSQQQALLMAALKAGNAPQ
MIPGNASLLNGNGSNPANGGLPSQSWTNLAYQNPGLAPVAAQNGATKVANNNQEFSFGNF
NFSTPGAYNTSSSVPANGAASAAANKSTSPTSSSLPSQSGKEYDFSSLTQGLFSKR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaacgagaaggcctccgtctccaaggagctcaacgccaagcacaagaagatattggaa
ggcctcctgcggctgcctgagaatagagaatgtgcagactgcaagtcaaagggtcctcga
tgggcaagtgtaaatcttgggatctttatatgcatgcagtgttctggaattcatagaagc
ctcggggtacatatatctaaggtaagatcggctaccctggatacatggctgccagagcaa
gttgcatttattcaatcaatggggaatgaaaagtcaaatagctactgggaagcggagctg
ccccctaactatgatagggttgggatagagaacttcatccgtgcaaaatacgaggacaag
agatggataccgaggaatgggtcatcaagaccatcatctggtgctagagatgagaagagc
tcagagtcacaaactagtgttaacaggggtggccataatcaaagatcttcatttgagcaa
caccgcacttcaccagctgcagtgagcaaaattgctccagtggtttctaggacgcccacc
caggcaccacatcagccaaaagcacaaccatcagttcccaaggtttcacctcctcaaccc
gagaaatcacctcctaatgcaacaccaccaaaggttgagaggccatcagttgcaccacct
cctaaggttgactatgcaactgatctcttcaacatgttatcaatggatggaacaaccgag
aaagaagcagagtcatcttctaatgatgatagtgcatgggagggcttccagtctgcagag
ccagtacctagctcagacaaaaaggattctgctaagccagtagaaagtaagccccagtct
acatcaggcatagaggacttgtttaaagattcaccagctgtgacagtatcctcagctcca
gctgccccacaagtaaatgtgaagaatgatatcatgagtctgtttgagaagtccagtatg
gtttcgccatatgctgtccagcagcagcaacttgcttttatgaccccccagcagcttgca
cttctgtctcagcagcaagctttactaatggctgctcttaaagctggaaatgcaccccaa
atgattccagggaacgccagtctgctaaatggtaatggttctaatcctgccaatggaggc
ttgccttcacaaagctggacaaatcttgcttatcagaatcctgggttggctccagtagca
gcacagaatggtgccaccaaggttgcgaacaacaatcaggaattctcttttgggaatttc
aattttagtacacctggagcatacaacactagctcatctgtcccagcaaatggggccgca
agtgcagctgctaacaagagcacatccccgacctcttcttccctcccctctcaatcaggc
aaagaatatgatttttcatcattaactcaaggactgttctccaagcgatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346168
Entry
4346168           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor GTPase-activating protein AGD3
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4346168
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4346168
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4346168
Membrane trafficking [BR:osa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    4346168
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    4346168
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4346168
SSDB
Motif
Pfam: BAR_3 ArfGap BAR Ank_4 PH Ank Ank_5 Ank_3 Ank_2 PH_8 PH_11 PH_20 TipAS
Other DBs
NCBI-GeneID: 4346168
NCBI-ProteinID: XP_015648272
UniProt: Q0J435 A0A0P0XIZ2
LinkDB
Position
8:complement(26871288..26880078)
AA seq 831 aa
MLFAKLDDSPMLRTQIQSLEESAEILRERCLKFHKGCRKYTEGLGEAYDGDIAFASSLET
FGGGHNDPISVAFGGPVMTKFTIALRELGTYKEVLRSQVEHMLNDRLLNFVDIDLHDVKD
ARKRFDKASLLYDQVRDKYLSLKKGTRADITTAIEDELHNARSSFEQARFNLVTSISHIE
AKKRFEFLEAVSSTMDSHLRYFKQGYDLLHQMEPYINQVLAYAQQSRERANKEQASLVER
MHEYKKQIDREIRLSNGLTDAHNGDGIQTIARSSHKMIEAVMQSASKGKVQTIRQGYLSK
RSSNLRADWKRRFFVLDSRGMLYYYRKQINRTPGGCSSHPRSIGNPTEHGSGLLSRLFSS
HYHGIIHDEKSVARHTVNLLTSTIKVDAEQSDLRFCFRIISPTKVYTLQAESAIDQMDWI
EKITGVIASLLSSQSPEQCFLLSPKSCGHDGSASESSSFTSQDLEPSMYDDLTLEKNTGN
GQHDVRGTHYHKTNMKPEKPIDLLRKVDGNIICVDCGSMEPDWASLNLGALLCIECSGVH
RNLGVHISKVRSLTLDVRVWEPSVINLFQSLGNKFVNDVWEEVLPSSKNGESDDKLRAHG
LDTAWHFTVSKPKHSDPFSAKEKFIHAKYADKEFVRKYSMDEIQLAQQMWDNVTANDKRA
VYSLIVQSRANVNLVYGEMSYSSRSTTGRSSQQEHSSSPSDGSPVFFDCHSHEKVSPREP
LSPASTSSRVDDGEERCEGFSLLHLACHVADVGMVELLLQYGANVNAIDSRGRTPLHQCI
LKGRHIHAKLLLSRGANPQVADQDGRTALQCAIDGGTSDDEILVLLEDYTR
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgcttttcgccaagctcgatgactcgcccatgctccgcacgcagatacagtcactggaa
gaaagtgctgaaattctcagggagagatgtttgaagtttcataaaggttgccgcaagtat
acggaaggattaggagaagcttatgatggagatattgcatttgcaagctcactcgaaaca
tttgggggaggccacaatgaccctataagtgttgcttttggtggacctgttatgaccaaa
tttacaattgccttgagagaactaggcacatacaaggaagtcctccgctcccaggttgag
cacatgctaaatgacagattgctgaattttgtggacattgatttgcatgatgttaaggat
gcacggaagcgtttcgacaaggctagcctcttgtatgaccaggttcgtgataagtacctg
tcactgaagaaaggcacacgagctgacataacaactgccattgaagatgaacttcacaac
gctagatcttcatttgagcaagcccgtttcaacctggtcacttcaatttcccatattgag
gcaaagaagagatttgaatttttggaggctgttagttcaactatggattctcatcttcga
tattttaaacaaggatacgacctattgcatcagatggagccatatattaatcaggttctt
gcttatgcacaacaatcaagagaaagggcaaacaaggagcaagcctctcttgtagagaga
atgcatgaatacaaaaagcagatagatcgggaaattcgtttatcaaatggtttgactgat
gcccataatggtgatggaattcaaacgattgctagaagttcacataaaatgattgaggca
gtgatgcagtcggcctcaaaaggcaaggtccagaccattcgtcaaggttacctctcgaaa
agatcttcaaacttgagagctgattggaaaagaaggttttttgtccttgatagtcgagga
atgctgtactactatcgcaagcaaattaataggacacctggtggttgttccagtcaccca
agaagcattggcaaccccactgaacatggttctgggttgctgagcagactattctcatct
cattaccatggcattatacatgatgagaaatctgttgcacggcatactgtaaatttgctg
acatcaaccattaaagtggatgcagaacaatcagatctgaggttctgcttcagaataatt
tcacccacaaaggtctacacactacaggcagagagtgcaatagatcaaatggattggatt
gaaaagattactggtgtcattgcatctttgcttagctcacaatccccagaacagtgtttt
ctgctaagccctaagagctgtggccatgatggcagtgccagtgaaagtagctcctttact
agccaggatctggaaccttccatgtatgatgacttaacattggaaaagaacactggaaat
gggcaacatgatgtcagaggcacacattatcacaagactaacatgaaacctgaaaaacca
attgatttgcttaggaaagttgatggcaatatcatttgtgttgattgtggttctatggaa
cctgattgggcatcattaaaccttggtgcacttctgtgcatagagtgctctggggtacac
agaaatctcggagtgcatatatcaaaggtaagatctctgacgcttgatgtcagagtgtgg
gaaccatctgtaatcaatctctttcaatcattaggcaacaagtttgtcaatgatgtttgg
gaagaagttttaccttcgtcaaaaaatggtgaatctgatgacaagttgcgcgctcatgga
ttagatacggcatggcacttcactgtcagcaagcctaaacactcagatcctttctctgcc
aaagagaagtttatccatgccaagtatgctgacaaggaatttgtacgaaagtatagcatg
gatgagattcagctagctcagcagatgtgggataatgtaactgcaaatgacaagagagct
gtatacagtctcatcgtgcaatcccgcgccaatgtaaatttagtttatggagagatgtcc
tatagttcacgttcgactactggaagatcatctcagcaagagcactcttcctcaccatct
gatggaagccctgtatttttcgattgccattcacatgaaaaagtttctcctagagagccc
ctttctcctgccagcacaagttcacgtgtagatgatggggaagaaagatgcgaaggtttc
tcgttgcttcatcttgcatgtcatgttgcagatgttggaatggttgaattacttttgcag
tacggagctaatgtaaatgcaattgattcaagaggccggacaccccttcatcagtgtata
ttgaaaggaagacacatacatgctaagcttctactctccaggggggctaatccacaagtt
gcggaccaagatggcaggacggcattacagtgtgccatcgacggtggaacaagcgacgac
gagattcttgtgttgttagaagattatactagataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347541
Entry
4347541           CDS       T01015                                 
Name
(RefSeq) ADP-ribosylation factor GTPase-activating protein AGD3
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4347541
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4347541
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4347541
Membrane trafficking [BR:osa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    4347541
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    4347541
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4347541
SSDB
Motif
Pfam: BAR_3 ArfGap BAR PH Ank_5 Ank_4 Ank_2 Ank Ank_3 PH_8 BAR_2 PH_11 PH_20 PH_9 PH_13
Other DBs
NCBI-GeneID: 4347541
NCBI-ProteinID: XP_015612554
UniProt: A0A0P0XP26 Q0J0G6
LinkDB
Position
9:complement(19823420..19831348)
AA seq 836 aa
MFFTRLDDSPMFRKQIQSLEEGSELLRERCLRFHKGCRKYTEGLGEAYDGDIAFASSLEA
FGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVENMLNDKLLQFVDIDLHDVKD
ARKRFDKASLLYDQARERYLSLKKGTRTDVATAVEDELHSARSSFEQARFNLVTALSNIE
AKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLAYAQQSRERSNYEQAALVER
MQEFKRQIDRESRWSPNGINDSPNGDGIQAIGRSSHKMIEAVMQSASKGKVQTIRQGYLS
KRSSNLRGDWKRRFFVLDSRGMLYYYRKQNSRPSSGYTNQRSSAPSEHGSGLLSRWFSSH
YHGGVHDEKSVARHTVNLLTSTIKADADQSDLRFCFRIISPTKNYTLQAESAMDQMDWIE
KITGVIASLLSSQSPERRLLSSPKGSGHNRTASESSSFSSSTELDHSISEDCMLERNSGS
GYFDHSGRAIQHHRTSMKPDKPIDLLRKVVGNNICADCGAAEPDWASLNLGILLCIECSG
VHRNLGVHISKVRSLTLDVRVWEPSVINLFQSLGNTFANTIWEDMLPSSSSVDHGDNSRA
DGLENTSHNLIFSKPKHSDHIAVKEKFIHAKYAERDYVRKLNMDDSLVAQQMWENVSSNN
KKGVYSLIVGSNADVNLTYGQTSFNSALTLGKALLLQEQPTSPSDGSSRCFDRSSLERIS
PRDSLSLASTSARIDELDDCVEGLSLLHLACRVADVGMVELLLQYGANVNSADSRGRTPL
HHSILKGRHMFAKLLLSRGADSQATDRDGRTALQYAIDSGTIDDEEILVLLEDPSR
NT seq 2511 nt   +upstreamnt  +downstreamnt
atgtttttcaccaggctggatgactcgcccatgttcaggaagcagatacaatcccttgaa
gaaggttctgaattgctgagagagagatgtttgaggtttcataaaggttgccgcaaatac
actgaaggactaggggaagcatatgatggagatattgcatttgcaagttcactggaagca
tttggaggggggcataatgatccaatcagtgttgcttttggaggacccgtcatgaccaaa
tttacaattgccctgagagaaattggaacttacaaggaagtattgcgctcacaggttgag
aatatgctaaatgacaagttgctgcaatttgtggacattgatttgcatgatgtgaaggat
gccaggaagcgttttgacaaggctagccttctctatgaccaggctcgtgagaggtattta
tccttgaagaaaggcacacggacagatgtagcaactgcggtggaggatgagctccatagt
gccagatcctcatttgagcaagctcgtttcaacctggtgactgcactttcaaatatcgag
gccaagaaaagatttgaatttttagaggctgtcagtgggacaatggatgcacatctgcgc
tatttcaaacaaggatatgagctactccatcagatggagccatatatcaatcaagttctt
gcttatgcacagcaatcaagggaacggtctaactatgagcaagctgctcttgtagagagg
atgcaagagtttaaaaggcaaattgatcgggaaagtcgttggtcaccaaatggcataaac
gattcccctaatggtgatggaatacaagcaattggtagaagttcacacaaaatgattgag
gcggtgatgcaatcagcttcaaagggcaaggtacagaccattcgacaaggctatctctca
aagcgatcttcaaacttgagaggtgactggaaaagaaggttctttgttcttgatagccga
ggaatgttatattattatcgcaagcagaatagtagaccatctagtggttatactaaccaa
agaagtagcgctccgtcagagcatggttctgggttgcttagcagatggttctcttctcat
tatcatggtggagtacacgatgagaaatctgtagcaaggcataccgtgaacttgctaaca
tcaaccattaaagctgatgctgaccaatcggatctgcggttctgcttcagaataatttct
cccacaaaaaactacactttgcaggcagagagtgcgatggatcagatggattggattgaa
aaaataactggtgtcatcgcttctttgctgagctcccaatcgcccgaacggcgtcttctg
tcgagcccaaagggtagcggccataatcgaactgccagcgaaagtagttcctttagtagc
tcgacagaacttgaccattccattagtgaagactgcatgctggaaaggaactctggaagt
gggtattttgaccactctggcagagccatccagcatcaccgaaccagcatgaaacctgac
aagccaattgacttgcttaggaaagtggtcggcaataatatttgtgctgattgtggtgca
gcagagcctgactgggcatccctaaaccttggaattcttctatgcatcgaatgctctggg
gtacacagaaatctcggtgtgcatatatctaaggtaagatcactgacacttgatgtcagg
gtctgggagccatctgtaatcaatctcttccagtcattaggaaacacatttgccaacact
atctgggaagatatgttaccttcatcaagcagtgttgatcatggtgataattcaagggct
gatggactagaaaacacatcacataacttaattttcagcaagcctaaacactcggatcat
attgctgtgaaggagaaatttattcatgcaaagtatgccgagcgagattatgtgcgaaag
cttaatatggatgatagcctggtagctcaacagatgtgggaaaatgttagttcaaacaac
aagaagggggtttacagtctgattgtggggtcaaatgccgatgtaaatttaacttatggg
cagacatcatttaattcggccctaacccttggaaaagctctacttttacaagagcagcca
acttcaccatcagatggaagttccagatgttttgatcgtagttcacttgaaaggatttct
cccagggactctctttctcttgccagcacaagtgcacgtatagatgaattggatgattgt
gtcgagggattgtcattgcttcatctagcatgccgtgttgcagatgtgggtatggtcgaa
cttctcttgcaatatggtgccaacgtaaattctgcagactctagaggtcgaacgcctctt
catcacagcatcttgaaaggacgacatatgtttgcaaagttgttgctatccaggggcgct
gattcacaagccacggaccgagatggtagaacagcattacagtatgctattgacagtgga
actattgacgacgaagagattcttgttttgttagaagacccaagtagataa

DBGET integrated database retrieval system