KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325748
Entry
4325748           CDS       T01015                                 
Name
(RefSeq) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00511  Other glycan degradation
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4325748
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4325748
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    4325748
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     4325748
SSDB
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N LacZ_4 Glyco_hydro_2
Other DBs
NCBI-GeneID: 4325748
NCBI-ProteinID: XP_015620054
UniProt: A0A0P0VD52
LinkDB
Position
1:41954633..41962628
AA seq 1117 aa
MAVASASALFSAKNLPHKPWEDPSFFRWRKREAHVPLRSHDTPEGALKYWHERRNVNYLN
SDSAVWNDDAVRGALESAAFWSKGLPYVQTLSGYWKFLLASSPESVPEKFYDAYFNDSDW
EALPVPSNWQMHGFDRPIYTNVTYPFTMNPPFVPNDNPTGCYRTVFRIPKEWKGRRILLH
FEAVDSAFFAWVNGVPVGYSQDSRLPAEFEITDFCHPCDSEKENVLAVQVMRWSDGSYLE
DQDHWWLSGIHRDVLLVSKPQIFITDYFFKATLDEGFRVADIEVEVEIDSQKQDREHVST
LSIEATLYDNYGPADVLTSDMSAASVANLKLKPASRPKHCYGFHGYVLGGKVENPKLWSS
EHPNLYTLVVVLKDSNGKLIECESCQVGIRNVVLAHKQMLVNGCPVVIRGVNRHEHHPRV
GKTNLEACMIKDLVLMRQNNINAVRNSHYPQHPRWYELCDIFGLYVIDEANIETHGFDES
SHFKHPTLEPFWASAMLDRVVGMVERDKNHACIIVWSLGNESSYGPNHSAMSGWIRGKDP
TRPIHYEGGGSRTSSTDIVCPMYMRVWDILKIAQDPSENRPLILCEYSHAMGNSNGNIDA
YWMAIDNTVGLQGGFIWDWVDQGLLKEDADGSKNWAYGGDFGDTPNDLNFCLNGIVWPDR
TIHPAVHEVKYLYQPIKITMMDNMLKIENVHFFETTEALDFSWLLQGDGCALGSGSLNVP
SIAPQSTHLINMKSSPWFTIWSTCVVKEIFLSINVKLRYQTQWAKDGHILASAQICLPPK
KGFVPHAIALPRSSLVSERVGDHVLISKSNAWQIKVNSISGTIDSWKVNNIELMSKGIHP
CFWRTPTDNDKGGFYTKPYVSRWREASLDNISFYSSQFSLKELPDQTVEISTIYYGLPGN
QPKPDETSLSDESESVLFRVQMRGRIYDSGDVILDYEVSPKNDLPPLPRVGVVFNADKSL
SRAKWYGRGPFECYPDRKAAAHVGVYESGVDELHVPYIVPGECGGRADVRWVALQDADGF
GLFASAYGESPPMQVSASYYGAAELDRATHNHKLVKGDDIEVHLDHKHMGLGGDDSWSPC
VHEQYLLPPARYAFSVRLCPLLPSSSCHDIYHSQLPC
NT seq 3354 nt   +upstreamnt  +downstreamnt
atggctgtagcttctgccagtgcactgttttccgccaagaatcttccgcataaaccctgg
gaggacccgtcattctttaggtggagaaagcgggaggctcatgtgccgttgcgctcacat
gacacacctgaaggagccctcaagtattggcatgaacggaggaatgtgaactatcttaat
tctgactctgctgtttggaatgatgacgcggttcgtggtgccctggaaagtgctgcgttt
tggtccaagggcttgccatatgtccagactctaagtggatactggaagttccttttggct
tcctcgccagaatctgttccagagaaattctatgatgcctacttcaatgattcagattgg
gaggctttgccagttccctcaaactggcaaatgcatgggtttgaccgtccaatctacaca
aatgtcacttatcctttcaccatgaacccgccatttgtgccaaatgataatcctactggc
tgttataggacggtttttcgcatcccaaaagagtggaaaggtcgaagaatcttgttgcac
tttgaagctgttgattcagcgttttttgcttgggtaaacggcgttcctgttggatatagc
caggacagcaggcttcctgctgagtttgagatcacagatttctgccatccttgtgactca
gaaaaggaaaatgttcttgctgttcaagtgatgaggtggagtgacggttcctatcttgaa
gaccaggaccattggtggctatctggtattcacagggatgttctactagtatcaaagcca
cagatctttattacagattattttttcaaagcaaccttggatgaaggcttccgtgtagct
gatattgaggttgaggtggaaattgactcacaaaagcaggatcgggagcatgtctcaact
ttgtctattgaagcaacattgtatgacaattatggacctgctgatgttttaacttctgat
atgtctgctgctagtgtggccaatttgaagttgaagccagcttcaagaccaaaacactgt
tatggttttcatggttatgttcttggtggaaaagtagaaaatccaaaactttggtctagt
gaacatcccaacttatacactcttgttgttgtccttaaagattccaacgggaagctcatt
gagtgtgaatcatgccaagtaggaatccgtaatgtcgtcctggcacacaagcagatgctt
gtcaatggatgtcctgttgtaataagaggtgtcaacagacatgagcatcatccacgtgtt
ggaaagacaaatttagaagcttgcatgattaaggatctggttttgatgagacaaaacaac
attaatgctgttagaaacagccattatccccaacatccaaggtggtatgagctgtgtgac
atttttggactttatgtaattgatgaagccaacatcgagacgcatggctttgatgaatct
agccatttcaaacatcctacacttgaacccttctgggcaagtgctatgcttgatcgtgtt
gttggtatggtggagagagacaagaatcatgcatgcattatagtatggtccttgggaaat
gaatcttcgtatggaccaaatcactcagccatgtctggctggattcgtggaaaggacccg
acaaggcccatccattatgaaggaggtggttctagaacatcctccactgatattgtatgc
ccaatgtacatgcgtgtctgggatattcttaagatcgcacaagacccttctgaaaatagg
cccctcattctttgcgaatattcacatgctatgggaaacagtaatggaaatattgatgca
tattggatggccatagacaacactgttggactccaaggtggttttatatgggactgggtc
gatcagggtttactaaaggaagatgctgatggatctaaaaactgggcatatggtggcgac
tttggagacactccaaatgacttgaatttttgtcttaatggcattgtatggcctgatcgg
acaattcacccagctgtgcatgaagttaaatatttataccagcctatcaaaataacaatg
atggataacatgcttaagattgaaaacgtacatttttttgagacaacagaagctttggac
ttcagttggctacttcaaggagatggctgtgctttgggctctggttcacttaatgtccca
tccatagcaccacagagtactcatctgatcaatatgaagtcatcaccttggtttactatt
tggagtacttgtgtcgtaaaagaaatatttttgtccattaacgtgaaattgaggtaccaa
acacaatgggccaaagatggccatatcttggcttcagcacaaatttgtttacctccgaaa
aaaggctttgtccctcatgcgatagcactgcccaggagctctttggtttcggaacgtgtt
ggtgatcatgtactcatcagcaaaagtaatgcctggcaaatcaaagtaaacagtatttca
ggaacaatcgatagttggaaggtcaacaacattgagcttatgagcaagggaatacaccca
tgcttttggcgaacaccaactgacaacgacaagggaggcttctacaccaagccctatgtt
tcaagatggagagaagcttctctcgacaacatctcgttctacagcagccagttttctctg
aaggaattgccagaccaaaccgtcgagatctccaccatctactacggtcttcctgggaat
caaccaaagcctgatgaaacctctctctcagacgaatccgagtccgtcctcttccgggtg
cagatgcgcggccggatctacgactccggcgacgtgatcctggactacgaggtgagcccc
aagaacgacctgcctcctcttcctcgcgtcggcgtcgtgttcaacgccgacaagtccctg
agccgtgcaaaatggtacgggagggggccattcgagtgctacccggaccggaaggccgcc
gcgcacgtcggcgtgtacgagagcggcgtcgacgagctgcacgtgccgtacattgtcccc
ggcgagtgcggcggccgggctgacgtccggtgggtggcgctccaggacgccgacgggttc
ggcctcttcgcgtcggcctacggcgagtcgccgccgatgcaggtgagcgccagctactat
ggcgccgcggagctcgaccgcgcgacgcataaccacaagctcgtcaagggagacgacatc
gaggtgcatcttgatcacaagcacatggggctgggaggggacgacagctggtcgccgtgc
gtgcacgagcagtacttgctgccgccggcgagatacgccttctcggtgaggctgtgcccg
ttgctgccgtcgtcgtcgtgccatgacatctaccactctcagctaccctgttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339457
Entry
4339457           CDS       T01015                                 
Name
(RefSeq) beta-galactosidase 8 isoform X1
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa00511  Other glycan degradation
osa00531  Glycosaminoglycan degradation
osa00600  Sphingolipid metabolism
osa00604  Glycosphingolipid biosynthesis - ganglio series
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4339457
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4339457
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    4339457
   00604 Glycosphingolipid biosynthesis - ganglio series
    4339457
   00511 Other glycan degradation
    4339457
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339457
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     4339457
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4339457
SSDB
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Other DBs
NCBI-GeneID: 4339457
NCBI-ProteinID: XP_015639206
UniProt: Q0DGD7
LinkDB
Position
5:complement(26794391..26801519)
AA seq 673 aa
MGPSRSFQNLLLLLLPLALALCSAAASGEASRRFWVENDTFWKDGAPFQIVGGDVHYFRI
VPEYWKDRLLRAKALGLNTIQTYVPWNLHEPKPLSWEFKGFTDIESYLRLAHELDMLVML
RVGPYICGEWDLGGFPPWLLTIEPTIELRSSDSTYLSLVDRWWGVLLPKIAPLLYSNGGP
IIMVQIENEFGSFGDDKNYLHYLVEVARRYLGNDIMLYTTDGGAIGNLKNGTILQDDVFA
AVDFDTGSNPWPIFQLQKEYNLPGKSAPLSSEFYTGWLTHWGERIATTDASSTAKALKRI
LCRNGSAVLYMAHGGTNFGFYNGANTGQNESDYKADLTSYDYDAPIREYGDVHNAKYKAL
RRVIHECTGIPLLQLPSKIERASYGLVEVQKVASLFDVIHNISDALKVAFSEQPLSMELM
GQMFGFLLYTSEYQEKHSSSILSIPKVHDRAQVFVSCSHGDVRKPRYVGIVERWSSKTLQ
IPSLSCSSNVSLYILVENMGRVNYGPYIFDQKGILSSVEIDGIILRHWKMHPVSLNAVGN
LSKLQLIMQMTDAEASKVSIYGDSENKLQDVSLYLNEGISEEPAFYEGHFHIDSESEKKD
TFISFRGWNKGVAFVNNFNIGRFWPAIGPQCALYVPAPILKPGDNVIVIFELHSPNPELT
IKLVKDPDFTCGQ
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggggccgtccagaagcttccagaaccttcttctcctcctcctccccctcgcgctggcc
ctgtgctccgccgcggccagcggggaggcttcgagaaggttctgggtcgagaacgacacc
ttctggaaggatggcgccccgttccagatcgtcggcggcgacgttcactacttccgcatt
gtccctgagtactggaaagatcgccttttaagggcaaaggcgctgggcttgaacacaatt
cagacatatgttccttggaatctgcatgagccaaaaccgctgagctgggaattcaagggt
ttcacagatattgaatcatatttaagacttgctcatgaattagatatgctggtcatgctt
cgtgtaggtccatatatttgtggagaatgggacttggggggatttccaccttggttactg
accatagaaccaaccatcgaactgcgttcttcagattcaacctatctttccttggtggac
agatggtggggagtactactcccaaaaatcgcaccactattatacagcaatggaggtcct
atcatcatggtgcagattgaaaatgaatttggttcatttggagatgacaagaattatctt
cattaccttgttgaagttgccagaagatatcttgggaatgacattatgctgtatacaact
gatggtggtgccattggaaatctaaagaatggaacaattcttcaggatgatgttttcgct
gctgttgattttgatactggttccaatccatggccaatatttcaactacagaaggaatac
aacttgccaggaaaatcagctcctttaagctcagaattttacactggatggctaacacac
tggggggaaagaattgcaacaactgatgctagcagtacagctaaagctcttaaaagaatt
ttgtgccgcaacggttctgctgtactttatatggctcatggtgggactaattttgggttt
tacaatggtgcaaatactggtcaaaatgaatctgactacaaggcagacctcacttcatat
gactatgatgcaccaattagggagtatggggacgtgcataatgcaaaatacaaagcacta
agaagagttatacatgaatgcactggcattcctcttctccaacttccttccaaaattgaa
agagctagttatgggcttgtagaagtacagaaggtcgcttctttgtttgatgtcattcat
aacatcagtgatgctctgaaagtggctttttcagagcagcctctatccatggaactgatg
ggccagatgtttggttttctactgtacacatcagaatatcaagaaaaacattcatccagc
atcctatcaattccaaaggtacatgacagagctcaagtgtttgtgtcctgctcacacggt
gatgtcagaaaaccgagatatgttggcatagttgaaagatggtcgagtaaaacactacaa
ataccaagcttaagctgctcatctaatgtcagcttatatatcctggtagaaaacatgggt
cgagtaaattatggaccatatatttttgaccagaagggcatactatcttctgttgaaata
gatggcattattctccgtcactggaaaatgcatccggtttcacttaatgcggtgggcaac
ctttcaaaacttcaactaatcatgcagatgactgatgctgaagctagcaaagtatccatt
tatggtgattcagaaaataagttgcaggatgtatcgctctatctaaatgaagggatttca
gaggaaccggcattctatgaaggccattttcatattgactctgaatctgagaaaaaggac
acattcatatcatttcgaggttggaataaaggagtcgcttttgtgaacaacttcaacatt
ggaaggttctggccggccattggaccacaatgcgctctgtatgttcctgcgccgatcctc
aaacctggagataatgtcattgtgatctttgaactgcatagtccaaaccctgagctcacc
atcaagttagtgaaggatccagatttcacatgcggccagtga

DBGET integrated database retrieval system