KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325777
Entry
4325777           CDS       T01015                                 
Name
(RefSeq) ATP-citrate synthase beta chain protein 1
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4325777
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4325777
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     4325777
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4325777
  Exosomal proteins of bladder cancer cells
   4325777
  Exosomal proteins of melanoma cells
   4325777
SSDB
Motif
Pfam: Citrate_synt Ligase_CoA Succ_CoA_lig CoA_binding
Other DBs
NCBI-GeneID: 4325777
NCBI-ProteinID: XP_015621337
UniProt: Q93VT8
LinkDB
Position
1:complement(10999405..11006010)
AA seq 608 aa
MATGQIFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINPGSDGFQKLFFGQEE
IAIPVHPTIEAACNAHPTADVFINFASFRSAAASSMSALKQPTIRVVAIIAEGVPESDTK
QLISYARANNKVIIGPATVGGIQAGAFKIGDTAGTIDNIIQCKLYRPGSVGFVSKSGGMS
NEMYNTIARVTDGIYEGIAIGGDVFPGSTLSDHILRFNNIPQVKMMVVLGELGGKDEYSL
VEALKQGKVQKPVVAWVSGTCARLFKSEVQFGHAGAKSGGELESAQAKNQALKDAGAVVP
TSYEALETAIKETFEKLVEDGKISPVTEITPPPIPEDLKTAIKSGKVRAPTHIISTISDD
RGEEPCYAGVPMSTIIEQGYGVGDVISLLWFKRSLPRYCTQFIEMCIMLCADHGPCVSGA
HNSIVTARAGKDLVSSLVSGLLTIGPRFGGAIDDAARYFKDAYDRNLTPYEFVEGMKKKG
IRVPGIGHRIKSRDNRDKRVQLLQKYAHTHFPSVKYMEYAVQVETYTLSKANNLVLNVDG
AIGSLFLDLLSGSGMFSKQEIDEIVEIGYLNGLFVLARSIGLIGHTFDQKRLKQPLYRHP
WEDVLYTK
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggcgacaggtcaaattttctccaaaaccacccaagcgttattctataattataagcaa
cttccgatccaacggatgcttgattttgacttcctatgtgggagagaaacaccttctgtt
gctggaataatcaatcctggttctgatgggtttcagaaacttttctttggacaagaagaa
attgccattccagttcatcctacaattgaagctgcctgcaatgcacacccaactgctgat
gtatttatcaactttgcatcctttcggagtgctgccgcttcttcaatgtcagctttgaag
cagccaacaatcagagttgtagccatcatagcagagggtgttcctgaatcagatacaaaa
caacttattagttatgcacgtgccaacaacaaggtaatcattggaccagcaacagttgga
ggaatccaagctggtgctttcaagattggtgatactgctggaaccattgacaacattatt
caatgcaagctttacaggcctggatctgttggctttgtttctaaatcgggtggcatgtca
aatgagatgtacaacaccattgccagagtgacagatggtatttatgaaggaattgcaatt
ggaggggatgttttccctggctcaactctgtcagaccacatcctgcgtttcaacaacata
cctcaggtcaaaatgatggttgttcttggggagcttggaggaaaagatgagtattctctt
gttgaagccctgaaacaaggaaaggttcagaaacctgttgttgcatgggttagtgggaca
tgcgctcgtctattcaagtctgaagtgcagtttggccatgctggtgcgaaaagtggtggt
gagttggaatcagcacaagctaagaaccaggcactaaaagatgccggggcagttgtccct
acttcatatgaagctcttgaaactgcgatcaaggagacatttgagaaactggttgaggac
ggaaagatctctcctgttactgagattacaccacctcctattccagaggatcttaaaacc
gcaattaagagtgggaaggtccgagctcccacacacattatctccactatctcggatgac
agaggcgaggaaccctgctatgctggtgtccccatgtctacaattattgaacagggttat
ggagttggtgacgttatttcgcttttgtggttcaagcgcagtcttcctcgttactgcact
cagtttattgagatgtgcatcatgctttgcgctgatcatggtccttgtgtatccggtgct
cacaattctatagttactgctagggctggaaaggaccttgtttccagcttggtatctggt
ttattgacaattggcccccgttttggtggtgcaattgatgatgctgcccggtacttcaaa
gatgcatatgatagaaatctcacaccttatgagttcgttgagggtatgaaaaagaaggga
atccgtgtccctgggattggtcacaggatcaagagcagagacaacagagataagagagtg
cagcttctacagaaatatgcccacacacatttcccttctgtcaaatacatggagtatgct
gtccaggttgagacctacaccctgtcaaaagccaacaatttggttctgaacgtcgatggt
gcgattgggtcgcttttcttggatcttctttctggcagtggaatgttcagcaaacaagaa
atcgatgagattgttgagattggttaccttaatggactctttgtgcttgcgcgttcaatt
ggtctcatcgggcacacctttgaccagaagaggctcaagcaaccactctaccgccaccca
tgggaggatgtcctctacaccaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352549
Entry
4352549           CDS       T01015                                 
Name
(RefSeq) ATP-citrate synthase alpha chain protein 3
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4352549
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4352549
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     4352549
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4352549
  Exosomal proteins of bladder cancer cells
   4352549
  Exosomal proteins of melanoma cells
   4352549
SSDB
Motif
Pfam: Citrate_bind ATP-grasp_2
Other DBs
NCBI-GeneID: 4352549
NCBI-ProteinID: XP_015620598
UniProt: Q2QNG7
LinkDB
Position
12:23275220..23279092
AA seq 423 aa
MARKKIREYDSKRLLREHLKRLAAIDLHILSAQVTESTDFTELVNQEPWLSSMKLVVKPD
MLFGKRGKSGLVALNLDLAQVRQFVKERLGVEVEMGGCKAPITTFIVEPFVPHDQEYYLS
IVSERLGSTISFSECGGIEIEENWDKVKTVFLPTEKAMTPDACAPLIATLPLEVRTKIGD
FIRGVYSVFQDLDFSFLEMNPFTMVNGEPYPLDMRGELDDTAAFKNFKKWGNIQFPLPFG
RVLSPSESFIHELDEKTSSSLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELGN
YAEYSGAPNEEEVLQYARVVLDCATADPDGRKRALLIGGGIANFTDVAATFSGIIRALRE
KESKLKAARMNIYVRRGGPNYQTGLAKMRTLGAELGVPIEVYGPEATMTGICKQAIDCIM
AEA
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggcgcggaagaagatccgggagtacgactccaagcgcctcctaagggagcacctcaag
cgcctcgccgccatcgacctccacatcctctccgcccaggtcacggaatcaactgatttc
acagagctcgtcaaccaagagccatggctctcgtctatgaagttggttgtgaaacccgac
atgctgtttggcaaacgtgggaagagtggccttgtggccctcaacctagatcttgctcaa
gtccgccaattcgtcaaagagcggttgggagttgaggttgagatgggtggctgcaaggct
cctattacaacattcatagttgagccatttgttccacatgatcaagagtactatctttct
attgtatcagagaggcttggttccaccattagcttctcggagtgtggaggtattgagatc
gaggagaactgggataaggtcaagacagtttttcttcccaccgagaaagcaatgacacct
gatgcgtgtgctccattgattgccaccctaccgttagaggttcggacaaaaataggtgat
ttcatcagaggtgtatattctgttttccaagacttggatttctcattccttgagatgaat
ccgttcaccatggtgaatggggaaccatatcctctagacatgagaggagaattggacgac
acagctgcctttaagaactttaagaagtggggaaacattcagttccctctgcctttcgga
agagtcctcagcccctctgaaagctttatccatgaactggatgagaagacaagctcatcg
ctcaaattcacagtcctgaacccgaaagggcgcatttggacaatggttgcaggtggtggt
gctagtgtcatatatgctgatactgttggagatttgggatatgcgtcagagcttggaaat
tatgcagaatacagcggcgctcccaacgaggaggaggttctgcagtatgctagagtggtt
ttggattgtgccactgctgatcctgatggccgtaagagagctcttctcattggaggtggt
atagcgaacttcactgatgtcgctgctacattcagtggcatcattcgagctttaagagag
aaggaatccaaattgaaggctgcacggatgaacatttacgttcggagaggtggtccaaac
taccaaactggccttgccaaaatgcgtacactaggtgcagaacttggtgttccaattgag
gtatatggaccagaggcaacaatgactggaatctgcaagcaagccattgattgcatcatg
gctgaagcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272295
Entry
9272295           CDS       T01015                                 
Name
(RefSeq) ATP-citrate synthase alpha chain protein 2
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    9272295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9272295
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     9272295
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9272295
  Exosomal proteins of bladder cancer cells
   9272295
  Exosomal proteins of melanoma cells
   9272295
SSDB
Motif
Pfam: Citrate_bind ATP-grasp_2
Other DBs
NCBI-GeneID: 9272295
NCBI-ProteinID: XP_015617859
LinkDB
Position
11:28474107..28478028
AA seq 502 aa
MLLFYTDAAGCLLSRSNLEHSESSSLYSFHSSQRRNVHTPPPPSSRWLRSLRLPTYLCSW
FAEPSSRTHAPLAAAANQAMARKKIREYDSKRLLKEHLKRLAGIDLQILSAQVTQSTDFT
ELVNQQPWLSTMKLVVKPDMLFGKRGKSGLVALNLDIAQVKEFVKERLGVEVEMGGCKAP
ITTFIVEPFVPHDQEYYLSIVSERLGSTISFSECGGIEIEENWDKVKTIFLPTEKPMTPD
ACAPLIATLPLEARGKIGDFIKGVFAVFQDLDFSFLEMNPFTIVNGEPYPLDMRGELDDT
AAFKNFKKWGNIEFPLPFGRVLSSTEGFIHDLDEKTSASLKFTVLNPKGRIWTMVAGGGA
SVIYADTVGDLGYASELGNYAEYSGAPNEEEVLQYARVVLDCATADPDGRKRALLIGGGI
ANFTDVGATFSGIIRALREKESKLKAARMHIYVRRGGPNYQTGLAKMRKLGAELGVPIEV
YGPEATMTGICKQAIECVMAAA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcttcttttctacactgatgctgcaggttgcttacttagtagatccaatctagaacac
agcgagtcatcttctttatattcattccattcctcccaaagacgcaacgtgcacacacca
ccaccaccttcatctcggtggcttcgttcactccgcctacctacctacctttgcagttgg
tttgctgaaccctcctcaagaacccacgcgcctctcgcggcagcagctaaccaagccatg
gcgcgcaagaagatccgggagtacgactccaagcgcctcctcaaggagcacctcaagcgc
ctcgccggtatcgacctccagatcctctccgcccaggttacacaatcgacggacttcaca
gagctggtaaaccagcagccatggctgtcaaccatgaagttggtcgtgaagcccgacatg
ctgttcgggaagcgtggcaagagcggacttgtggccctcaacctagatattgctcaagtc
aaggagtttgtgaaggagaggctgggagttgaggtcgagatgggtggctgcaaggctcca
atcaccaccttcattgtggagccatttgtaccccatgatcaagaatactacctttctatt
gtctcggagaggctgggcagcaccattagcttctcggaatgtggaggaatagaaattgag
gagaactgggacaaggttaagacaatttttcttcccactgagaagccaatgacacctgat
gcatgtgctcccttgattgctacccttccattggaggcacgtggaaaaattggtgatttc
attaaaggagtctttgctgttttccaagacttagatttctcatttctcgagatgaaccca
tttaccatcgtgaatggagagccgtatcctctggacatgagaggagaattagatgacaca
gcagctttcaaaaacttcaagaagtggggaaatatcgaattcccactaccattcggtaga
gttctcagttctacagaaggctttatccatgacttggatgagaagacaagtgcatctctg
aagttcaccgttttgaacccaaaggggcgcatctggacaatggttgctggaggtggtgcc
agtgtcatatatgctgatacagtcggagatttgggatatgcttcagaattaggaaactat
gcagagtatagcggtgctcccaatgaggaggaggttctgcagtatgctagagtagtactt
gattgtgcgactgctgatcctgatggccgcaagagagctcttctcattggagggggtata
gctaacttcaccgacgtcggggccacatttagcggcatcattcgggccttaagagagaag
gaatccaagttgaaggctgcaaggatgcacatctatgtccgacgtggtggtccaaattac
caaactgggctggctaaaatgcgcaagcttggcgcagaactcggcgtcccgattgaggtg
tatgggccagaagcgacgatgactggaatctgcaagcaagcaattgaatgcgttatggcc
gcagcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272485
Entry
9272485           CDS       T01015                                 
Name
(RefSeq) ATP-citrate synthase subunit alpha chain protein 1
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    9272485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    9272485
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     9272485
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9272485
  Exosomal proteins of bladder cancer cells
   9272485
  Exosomal proteins of melanoma cells
   9272485
SSDB
Motif
Pfam: Citrate_bind ATP-grasp_2
Other DBs
NCBI-GeneID: 9272485
NCBI-ProteinID: XP_015617372
LinkDB
Position
11:complement(28335194..28338787)
AA seq 424 aa
MARKKIREYDSKRLLKEHLKRLAGIDLQILSAQVTQSTDFTELVNQQPWLSTMKLVVKPD
MLFGKRGKSGLVALNLDIAQVKEFVKERLGVEVEMGGCKAPITTFIVEPFVPHDQEYYLS
IVSERLGSTISFSECGGIEIEENWDKVKTIFLSTEKPMTPDACAPLIATLPLEARGKIGD
FIKGVFAVFQDLDFSFLEMNPFTIVNGEPYPLDMRGELDDTAAFKTSRSKWGNIEFPLPF
GRVLSSTEGFIHDLDEKTSASLKFTVLNPKGRIWTMVAGGGASVIYADTVGDLGYASELE
NYAEYSGAPNEEEVLQYARVVLDCATADPDGRKRALLIGGGIANFTDVGATFSGIIRALR
EKESKLKAARMHIYVRRGGPNYQTGLAKMRKLGAELGVPIEVYGPEATMTGICKQAIECV
MAAA
NT seq 1275 nt   +upstreamnt  +downstreamnt
atggcgcgcaagaagatccgggagtacgactccaagcgcctcctcaaggagcacctcaag
cgcctcgccggtatcgacctccagatcctctccgcccaggttacacaatcgacggacttc
acagagctggtaaaccagcagccatggctgtcaaccatgaagttggtcgtgaagcccgac
atgctgttcgggaagcgtggcaagagcggacttgtggccctcaacctagatattgctcaa
gtcaaggagtttgtgaaggagaggctgggagttgaggtcgagatgggtggctgcaaggct
ccaatcaccaccttcattgtggagccatttgtaccccatgatcaagaatactacctttct
attgtctcggagaggctgggcagcaccattagcttctcagagtgtggaggaatagaaatt
gaggagaactgggacaaggttaagacaatttttctttccactgagaagccaatgacacct
gatgcatgtgctcccttgattgctacccttccattggaggcacgtggaaaaattggtgat
ttcattaaaggagtctttgctgtcttccaagacttggatttctcatttctcgagatgaac
ccatttaccatcgtgaatggagagccgtatcctctggacatgagaggagaattagatgac
acagcagctttcaaaacttcaagaagtaagtggggaaatatcgaattcccactaccattc
ggtagagttctcagttctacagaaggctttatccatgacttggatgagaagacaagtgca
tctctgaagttcaccgttttgaacccaaaggggcgcatctggacaatggttgctggaggt
ggtgccagtgtcatatatgctgatacagtcggagatttgggatatgcttcagaattagaa
aactatgcagagtatagcggtgctcccaacgaggaggaggttctgcagtatgctagagta
gtacttgattgtgcgactgctgatcctgatggccgcaagagagctcttctcattggaggg
ggtatagctaacttcaccgacgtcggggccacatttagcggcatcattcgggccttaaga
gagaaggaatccaagttgaaggctgcaaggatgcacatctatgtccgacgtggtggtcca
aattaccaaactgggctggctaaaatgcgcaagcttggcgcagaactcggcgtcccgatt
gaggtgtatgggccagaagcgacgatgactggaatctgcaagcaagcaattgaatgcgtt
atggccgcagcataa

DBGET integrated database retrieval system