KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325792
Entry
4325792           CDS       T01015                                 
Name
(RefSeq) probable signal peptidase complex subunit 3
  KO
K12948  signal peptidase complex subunit 3 [EC:3.4.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4325792
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     4325792
SSDB
Motif
Pfam: SPC22 OMP_b-brl
Other DBs
NCBI-GeneID: 4325792
NCBI-ProteinID: XP_015625366
UniProt: B9EZC5 Q0JQY7
LinkDB
Position
1:1754326..1757676
AA seq 168 aa
MHSWVQRLLTTATTAALLLLAACCAASALDAFHVPSVQAQAHVTKINRFHKQLNGNDKVT
LTFNLSANLESLFTWSTKQVFVFLTAEYENSKNSLNQVSLWDHIIPDKDKANLQVEVKSK
YPLIDQGSSLRGKKVQLVLHWHVMPKAGVMIRDRMALSEFNLPDSYTS
NT seq 507 nt   +upstreamnt  +downstreamnt
atgcactcttgggtgcagcggctgttgacgacggcgacgacggcggcgctcctcctcctc
gccgcctgctgcgccgcctccgcgctcgacgccttccacgtcccctccgtccaggcgcaa
gcccatgttacaaagataaaccgattccacaagcagctcaatggcaacgacaaggtgaca
ctgaccttcaacttgtccgcaaatttggagtcactattcacttggagcacaaaacaggtg
ttcgtttttctgactgctgagtatgagaactcgaagaattcgcttaaccaggtttcattg
tgggaccacatcatacccgacaaggacaaagcgaatttgcaagtggaggtgaagagcaag
tatcctctgattgaccagggaagcagtttgcgcgggaagaaagttcagcttgttctacac
tggcatgtcatgcccaaggccggtgtaatgatccgggatcgaatggctctctcagagttc
aacctgccagactcctatacatcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347817
Entry
4347817           CDS       T01015                                 
Name
(RefSeq) signal peptidase complex subunit 3B
  KO
K12948  signal peptidase complex subunit 3 [EC:3.4.-.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4347817
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-
    3.4.-.-
     4347817
SSDB
Motif
Pfam: SPC22
Other DBs
NCBI-GeneID: 4347817
NCBI-ProteinID: XP_015651326
UniProt: B9G505 A0A8J8XUN0
LinkDB
Position
9:complement(22092205..22095293)
AA seq 167 aa
MHSFGHRANAVATFAVTILAAMCFAASFSDHFNSPSPTASVKILNINWFQKEANGNDEVS
MTLNISADLSSLFTWNTKQVFVFVAAEYETPQNALNQVSLWDGIIPSKEHAKFLIHTTNK
YRFIDQGSNLKGKDFNLTMHWHIMPKTGKMFADKIVMTGYRLPEQYR
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcattcgttcgggcaccgcgccaacgcggtggcgacgttcgcggtgaccatcctggcc
gccatgtgcttcgccgcctccttctccgaccacttcaactccccttcccccaccgcctct
gtcaagatcttgaacataaactggtttcagaaggaagccaacggcaacgacgaggtcagc
atgacgctgaacatttcggctgacctctcgtctctgttcacgtggaacacaaaacaggtc
tttgtttttgtcgcagctgaatatgagactccacaaaatgccttgaatcaagtttccctc
tgggatggcattataccatcaaaagagcacgccaagtttttgatccatacaacaaacaag
tacagatttattgaccagggaagcaacctcaaaggaaaggattttaacctgacaatgcac
tggcatattatgccaaagaccggcaagatgtttgcagacaagatagtcatgacaggttat
cggctacctgaacagtacagatag

DBGET integrated database retrieval system