KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325837
Entry
4325837           CDS       T01015                                 
Name
(RefSeq) crossover junction endonuclease MUS81 isoform X1
  KO
K08991  crossover junction endonuclease MUS81 [EC:3.1.22.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4325837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325837
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-
     4325837
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     4325837
SSDB
Motif
Pfam: ERCC4
Other DBs
NCBI-GeneID: 4325837
NCBI-ProteinID: XP_015622535
UniProt: Q8GT06
LinkDB
Position
1:41691148..41698707
AA seq 660 aa
MAPEARQLKVHLRENEAVAQCVLEKWRSMEEKPGGLKENLAHTLYKSYRNVCAAKEPIRS
LKDLYQIKGVGKWVIRQLKGSFPESSPDLSPPESNAAGEKGKKAGGSKRYVPQKNSAAYA
ILITLHRETINGKSHMKKQELIDATEASGLSRSAIGPDKSKAKPGAFASSQKDWYTGWSC
MKTLTSKGLVAKSGNPAKYMITEEGKSTALECLSRSGLDDHAAPLVINSAPDTSNASHKL
NNICMTSFVETSSGPSRAIGRPKTSIANPATKTSPEVTYLTSQESLNYNSDVRTAENCAE
EIILSDSDSEELYTENYPLIGSEEFTERVAPPILNASNSGKTTTNYRFSDCSASISPRSS
EGTFEMQSSSTMGIAEFNMLDNDTVCMDNSILAMPPRRSSKNFLEDYEVVLILDDRENFG
GRSRKTVDNIHSQFRVPVEIKHLPVGDGIWIARDRKLHTEYVLDFIVERKNVADLCSSIT
DNRYKDQKLRLKKCGLRKLIYLVEGDPNPLDTSERIKTACFTTEILEGFDVQRTPGYAET
VRTYGNLTHSITEYYSTHFSTGANTSQVCLTYDEFTKKCDDLKKITVSDVFALQLMQVPQ
VTEEAALAVIGLYPTLFSLAKAYSMLDGDTHAQEKMLKNKSTLINAGASRNIFKLVWAEG
NT seq 1983 nt   +upstreamnt  +downstreamnt
atggcgccggaggcgaggcaactcaaggtgcacctccgggagaacgaggcggtcgcgcaa
tgcgtcctggagaagtggcgctcgatggaggagaagccgggcggcctcaaggagaacctg
gctcacacgctctacaaatcctaccgcaacgtctgcgccgccaaggagcccatccgatcc
ctcaaggacctgtatcagatcaagggcgttgggaaatgggtcataaggcaactgaaagga
tcctttccagagtctagtccagatttatctcccccggaaagtaatgcagcaggagaaaag
gggaagaaagcaggagggtcaaagcgttatgtgccacagaagaattctgctgcttacgcg
atactgatcacgctccatagggaaacaatcaatgggaagagtcatatgaagaagcaagag
cttattgacgccactgaagcaagtggcctgtcacgaagtgcaattggtccagacaaaagt
aaagcaaaaccaggggcttttgcaagttctcagaaggactggtacactggatggagctgc
atgaaaacattgacatctaaaggactggttgcaaagtccggtaaccctgcaaagtatatg
ataactgaagaagggaaatcgactgctcttgaatgtctctcaaggtctgggttagatgat
catgcagcacctttggtgataaacagtgctcccgacacatctaatgcaagtcataagttg
aataatatttgcatgacttcttttgttgagacatcatccggaccttctagggcaattggt
agacccaaaacatctattgccaaccctgccactaagacatcaccagaagtgacatatttg
acaagtcaagaatcactcaattacaactctgatgttagaactgctgagaactgtgctgaa
gaaatcattcttagtgactcagattctgaagaattatatacagagaactatcctctaata
ggttctgaagaatttactgagagggttgcccctccaatattgaatgcaagcaactctggc
aagactactacaaattacagattctcagactgttcagcttctatttctcctcgttcgtct
gaaggaacatttgagatgcagtcttctagtacaatgggtattgctgaattcaatatgctg
gacaatgatactgtatgtatggacaattctatactagccatgccacctcggcgatccagt
aaaaattttcttgaagattatgaagttgtgttgatattggatgatcgtgaaaattttggg
ggtcgttcaagaaaaactgttgataacatacattcacaatttcgtgtacctgtagagata
aagcatttgcctgttggggatggtatttggattgctcgtgatagaaagcttcacacagag
tatgttcttgatttcattgttgaaaggaagaatgttgcagatttgtgtagttcaatcaca
gacaaccgatacaaagatcagaagttaaggctcaagaaatgtggcctaaggaagctgata
tatctggttgaaggtgatccaaaccctcttgatacatcagaaaggatcaaaactgcctgc
ttcaccactgaaattcttgaaggatttgatgtccagagaacccctgggtatgctgagact
gtaaggacatatggcaaccttactcattcaataaccgaatactacagcacacacttttct
actggtgctaatacttctcaagtttgcctgacctatgatgagtttacgaagaagtgtgat
gaccttaagaagataactgtgagtgatgtattcgcccttcaacttatgcaggtgccacaa
gtgacagaagaagctgcacttgctgtgatagggctctatccaactcttttctcacttgct
aaggcgtactctatgcttgatggtgatacccatgcccaagagaagatgttgaagaacaag
agcacgctgataaatgcaggggctagcagaaacatattcaagcttgtctgggctgaagga
taa

DBGET integrated database retrieval system