KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325862
Entry
4325862           CDS       T01015                                 
Name
(RefSeq) disease resistance protein RPS2
  KO
K13459  disease resistance protein RPS2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4325862
SSDB
Motif
Pfam: NB-ARC LRR_8 LRR_4 LRR_9 AAA_16 AAA_22 ATPase_2
Other DBs
NCBI-GeneID: 4325862
NCBI-ProteinID: XP_015621141
UniProt: A2ZYK1 Q5ZAY2
LinkDB
Position
1:complement(33460383..33463933)
AA seq 909 aa
MEFVASIVDAVFRPLKDYFARTFGYVMSCGDYIDLLGHEMDELKSKRDDVKRLVDVAERR
GMEATSQVKWWLECVSRLEDAAARIEEEYQARLRLPPEQAPGLRATYHLSQRADEMFAEA
ANLKEKGAFHKVADELVQVRFEEMPSAAVVGMDAVLQRLHACVRHGDVGIVGIYGMAGVG
KTALLNKYNNDFLINSPDINVAINIEVGKEFSLDDIQKIIGDRLGVSWENRTPRERAGML
YRVLTKMNFVLLLDDLWEPLNFQMIGIPVPKHNSKSKIVLTTRIEDVCDRMDVRRKLKME
CLPWEPAWELFREKVGEHLMFSSIEIQEQAKALAMKCGGLPLALITVGRAMASKRTEKEW
KHAITVLKVAPWQLLGMEMDVLMPLKNSYDSLPSDKLRLCLLYCSLFPEEFSISKEWIIG
YCIGEGFIDDLYTDMDEIYNKGHDLLGVLKIACLLEKGDDEDHISMHPMVRAMALWIASD
FGTKETKWLVRAGVGLKEAPGAEKWSDAERISFMRNNILELYERPNCPLLKTLMLQVNPA
LDKICDGFFQFMPSLRVLDLSHTSIHELPSGISSLVELQYLDLYNTNIKSLPRELGALVT
LRFLLLSHMPLDLIPGGVISSLTMLQVLYMDLSYGDWKVDATGNGVEFLELESLRRLKIL
DITIQSLEALERLSLSNRLASSTRNLLIKTCASLTKVELPSSRLWKNMTGLKRVWIASCN
NLAEVIIDGNTETDHMYRQPDVISQSRGDHYSNDEQPILPNLQNIILQALHKVKIIYKSG
CVQNITSLYIWYCHGLEELITLSDDEQGTAANSSEQAARICRDITPFPNLKELYLHGLAN
CRALCSTTCFLRFPLLGNLKIVDCPKLKKLELPVGNLNAVQCTREWWDALEWDDAEVKAS
YDPLFRPLH
NT seq 2730 nt   +upstreamnt  +downstreamnt
atggagttcgtggcgtccatcgtggacgcggtgttccggccgctcaaggactacttcgcc
cggacgttcgggtatgtcatgtcctgcggcgactacatcgacctgctgggccacgagatg
gacgagctcaagagcaagcgcgacgacgtgaagcgcctggtcgacgtcgccgagcgccgg
ggcatggaggccaccagccaggtcaagtggtggctcgagtgtgtctccaggctcgaggac
gccgccgcccggatcgaggaggagtaccaggcgcgcctccgccttccccccgagcaggcg
cccggcctcagggccacctaccacctcagccagagggccgacgagatgttcgccgaggcc
gccaacctcaaggagaagggcgcgttccacaaggtcgccgacgagcttgtgcaggtccgc
ttcgaggagatgcccagcgcggccgtcgtcggcatggacgctgtgcttcagaggctccac
gcgtgcgtccggcacggcgacgtgggcatcgtcggcatctacggcatggccggggtcggc
aagaccgcgctgctgaacaagtacaacaacgatttcctcatcaactcgccggacatcaat
gtcgccatcaacatcgaagtcggcaaggagttcagtctggatgatatccagaaaatcatc
ggcgaccgcctcggcgtgtcgtgggagaacagaacgcccagggagcgtgccggaatgctc
tacagagtgctcaccaagatgaacttcgtgctgctgctggacgacctctgggagccactc
aacttccagatgatcggaattcccgtacctaagcacaactccaagagcaagatcgtgttg
acgacgaggattgaggacgtgtgtgaccgcatggatgtccgccgcaagctcaagatggag
tgcctgccatgggagcccgcttgggagctcttccgcgagaaggtcggggagcatctcatg
ttttccagcattgagattcaggaacaggcgaaggcgctggcgatgaagtgtggcggcctg
ccgctcgcgctcatcaccgtcggccgggcgatggccagcaagcgcacagaaaaagagtgg
aagcatgccatcaccgtgctaaaggttgccccatggcagcttcttggcatggagatggat
gttctaatgcctctcaagaacagctacgatagtttgcccagtgacaagctaaggctttgt
ctactgtattgctcactgttcccagaggaattctccatttctaaggaatggataataggg
tactgcatcggtgaaggtttcattgatgacctgtacactgacatggatgagatttataac
aaagggcatgaccttcttggtgttctcaagattgcctgtttgctggagaaaggggatgac
gaggatcatatcagtatgcatcccatggtccgtgccatggctctgtggatagcatcagat
tttggcacaaaagaaacaaaatggcttgtccgtgccggagttgggctcaaggaggcacca
ggtgcagagaaatggagcgacgctgagcggatttctttcatgcgaaacaacattcttgag
ctgtatgagagacctaattgccctctgctgaaaactttgatgctacaggtcaaccctgca
ttggataagatatgtgacggcttcttccaattcatgccatctctcagggttttagattta
tcacatacttctatccatgaattaccttccgggatcagttcattagttgagttgcagtac
cttgatttgtataacacaaacatcaaatcacttccaagggagcttggagcactggtaacc
ctgcggttcctgctgctttcgcatatgccactggatttgataccaggtggtgtaataagc
agcctgacaatgctgcaagtattgtacatggatctcagttatggagactggaaggttgat
gcaaccggaaatggagttgaatttctggagcttgaaagcctacgcaggctcaagatactc
gatatcacaatacagtctctcgaggctctggagagactgtccttgtcgaatcgcctcgct
agctcgacaagaaatctactcataaagacatgtgctagccttacaaaggtagagcttcct
tcaagcagactttggaagaacatgaccggactcaagagagtgtggatcgcgagctgcaac
aacttagcggaggtaatcatcgatggcaacacagaaactgaccacatgtatagacaacct
gatgttatctcgcaaagccggggagatcattattccaatgacgagcagcccatccttcca
aacctgcaaaatatcatccttcaggcacttcataaggtaaagatcatctacaaatccgga
tgtgtccagaacataacatcgttgtacatctggtattgccatgggctggaggagctgatt
actctcagcgatgatgaacaaggaacagcggcaaacagcagtgaacaagctgcaagaatt
tgcagagacatcacacccttccctaacctcaaagaactgtatctccatggcttggcaaac
tgcagggcattgtgcagcactacgtgcttcctgcggttccccttgctggggaacctgaag
attgtcgactgcccgaagctgaagaagctcgagctccctgtcggtaatctgaatgcggta
caatgcacaagggagtggtgggatgcgttggagtgggatgatgccgaagtcaaagcatct
tacgatccactgttccgtccactgcactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336120
Entry
4336120           CDS       T01015                                 
Name
(RefSeq) probable disease resistance protein At4g14610
  KO
K13459  disease resistance protein RPS2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4336120
SSDB
Motif
Pfam: NB-ARC LRR_8 AAA_22 AAA_16 ATPase_2 TniB LRR_4 MeaB AAA_18 LRR_9 NACHT AAA_24 AAA_19 PspA_IM30 PRK AAA
Other DBs
NCBI-GeneID: 4336120
NCBI-ProteinID: XP_015635417
UniProt: A3AUQ7 Q7XQN2
LinkDB
Position
4:23506463..23510045
AA seq 928 aa
MEFAIDNIFRPLRNLFTRTVGYIRALESEARWLKSQRDDVMKEVRLAERQGMEATNQVSH
WLEAVASLLVRAIGIVAEFPRGGAAAGGLGLRAAYRLSKRADEARAEAVSLVEQRSTFQK
VADAPVFACTEVLPTAAPSIGLDALLARVANAFQEGGTSVIGIYGAPGVGKTTLLHHFNN
TFLSASAASMDIHLVIYVEVTERYSAGAVQKAIGGRLGLRWEDGKSTKEKALALCTYLHR
WNFVLLLDDVWEPLNLAELGVPVPGRHGKSKVLLTTRLEHVCDQMDVTRKIKVECLSAAD
SWELFKNKVGNAFVTSREIQPLAQAMASRCGGLPLGLITVARAMACKRVTREWEHSMAVL
NLAPWQLDGVEANLLVSLKRSYDSLRDDSLRICLLYCSLFSGETSKELLVESFIGEGFVS
DVSADDMDDLYNKGHYMLGILVTSSLLEAAGDYHVTMHPMVRAMALWVVADCGRIDNKWL
VRAGLVTSAAPRADKWTGAERVSLMRTGINELNDAPTCSVLKTLLLQSNRLLGRICHDFF
SFMPCLRLLDLSDTLITALPSEINLLVTLQYLRLNNTTIRSLPAGIGALVNLRFLLLSNV
PVQTIAAGVLNPLTALQVLCMDHCWSSWMDVGSCEPESGDSRKRRRHDLRQRVNLRELES
LKSLQMLDISVQTLHSLEKLSQSPHLAEHLRNLHVQDCSDLPSIQFSPSSLWRHMSRLKG
IIISGCCNLENVIITGGEYKGEQPWSLDRTVSMMRYRVPDKPLDVDSVYRPQTSQSLDMD
CRKLVPLLPSLQSIILRKLPKAKIVWQGGSLEYLSSLSISSCSVLEHLISYDTEGLSHGS
PAETVFPSLKELELHDLPNMRSIGPESIAVNFPSLASLKVVRCSRLKKLNLVAGCLKELQ
CTQTWWNKLVWEDENLKTVFLSSVKPLA
NT seq 2787 nt   +upstreamnt  +downstreamnt
atggaattcgcgattgacaacatcttccggcctctgcggaacttgttcacgcggacggtg
ggctacatccgggcgctcgagtccgaggctagatggctgaagagccagcgcgacgatgtg
atgaaagaggtgaggttagcggagaggcagggcatggaagcgaccaaccaggtgagccac
tggctcgaagccgttgcctcgctcttggttcgtgccatcgggatcgtcgcggagttccct
agaggaggggcggcggcgggggggcttggcctgcgtgcagcctaccggctgagcaagcgc
gccgacgaggcgcgcgccgaagccgtgtcacttgtagagcaaagatccaccttccagaag
gtggcggacgcgcccgtgttcgcctgcacggaggtgctcccgacggcggccccgtcgatc
ggcctggacgcgctcctggcgcgggtcgcgaatgcgttccaggagggcggcaccagcgtg
atcggcatctatggcgcgccgggcgtcgggaagaccaccctgttgcaccacttcaacaac
accttcctctcggcgtccgcggcgtccatggacatacatctcgtcatctacgtggaggtc
acggagcgctacagcgcgggcgccgtccagaaggccatcggcggccgactaggcctccgg
tgggaggacgggaagagcaccaaggagaaggcgctcgccctgtgcacgtatctccaccgg
tggaacttcgtgctcctcctggacgacgtgtgggagcccctcaacctcgcggagctcgga
gtccccgtgcccggccggcacggcaagagcaaggtgctgctgacgacgcggctcgagcac
gtgtgcgaccagatggacgtgacgaggaagatcaaggtggagtgtttgtccgcggccgat
tcgtgggagctgttcaagaacaaggtgggcaacgcgttcgtcaccagcagggagatccag
ccgcttgcccaggcgatggcgtcgcggtgcggcggcctgcccctcggtctcatcacggtt
gcacgggccatggcttgcaaaagggtaacgcgggagtgggaacatagcatggccgtgctc
aatctggcgccatggcagctcgacggcgtcgaggccaacctcctcgtcagcctgaagcgg
agctatgacagcttacgggacgacagcctcaggatctgcctcctgtattgctctttgttc
tcgggagagacgtccaaggaattacttgtcgagagcttcatcggagaaggatttgtgagc
gatgtgtctgctgatgacatggatgatctctacaacaaaggccactacatgcttggtatc
ctagtgacctcctctctgctggaagcagccggtgactaccatgtcaccatgcatcccatg
gtgcgagccatggccttgtgggtggttgcagattgcggcaggattgacaacaagtggcta
gtccgagcaggtcttgtgacaagcgccgcgccacgggcggataaatggacaggcgctgag
agggtgtcactgatgcggactggcatcaacgagctgaatgatgcaccgacgtgctctgtt
ctgaaaacgttgctgctccagagcaaccggctgctggggaggatatgccacgacttcttc
agcttcatgccttgtctcaggttgctggacctatcggacacgctgatcaccgcattgccc
tccgagatcaacctccttgtcaccctgcagtaccttcgtctcaacaacacgactatccgg
tccttgcccgctggaataggagccctggtgaacttgcgattcttgttgctgtccaatgtg
cccgtccaaaccattgccgccggcgtgctaaacccgctcacggcgctgcaggtcctgtgc
atggaccactgctggagcagttggatggacgtcggaagctgtgagcctgagtccggtgac
tcaagaaaacgaaggcggcacgacctccggcaacgcgtcaacctgcgcgaactcgagagc
ctgaaaagcttgcagatgcttgacatatccgtgcaaacgctccactctctggagaagctc
tcgcagtctcctcatctcgcagagcacttgcggaatttgcatgtccaggactgcagcgac
ttgccgagcatccagttttcgccttccagcctctggaggcacatgagcagattgaagggc
atcatcatcagtggctgctgcaacctggagaatgtcattattaccggaggtgaatacaag
ggcgagcaaccatggtcacttgatcggactgtcagcatgatgcgttacagggtgcccgat
aagcctttggacgttgacagcgtgtatcgtccacagactagccagtcattggacatggat
tgccgcaagctggtacccctgctgccttctctccaaagtatcatccttcgcaagctccca
aaggccaagattgtttggcagggtggcagcctggagtatttatcctccttgagcatttca
tcctgcagtgttcttgagcatcttatatcctacgacacagaaggattgagccatggatcg
cctgcggagacggtctttccaagcctcaaggagttagagttgcacgacttgccaaacatg
agaagcataggccctgaatccatagcagtgaatttcccaagcttggcgagcctcaaagta
gtcagatgcagcaggcttaagaagcttaatcttgtggcaggatgcctgaaagaactccag
tgtacacagacatggtggaacaagctagtatgggaggatgagaatctgaaaacggttttc
ttgtcttccgtgaaaccattagcctaa

DBGET integrated database retrieval system