KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325867
Entry
4325867           CDS       T01015                                 
Name
(RefSeq) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 1, chloroplastic
  KO
K08744  cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4325867
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     4325867
SSDB
Motif
Pfam: CDP-OH_P_transf HTH_31
Other DBs
NCBI-GeneID: 4325867
NCBI-ProteinID: XP_015625107
UniProt: Q5N9A1
LinkDB
Position
1:complement(33489284..33493004)
AA seq 329 aa
MAFLKTLNPLLRRSPTPIPNPRSLLSLDAFLAASSPTAASHATAPAPFAAAAHHHVPIRS
GGPLFLSSPPWMLSQSATPLTAAAAALRARLRRARALAGGGAQAVADAVGWEPRRISRDE
SEVAEAVTGGRERFLNLPNLVSIGRMASGPVIGWMIVNEWYLPAFGTLALSGASDWLDGF
LARKMGINSVFGSYLDPLADKVLIGCVAIAMVEKDLLHPGLVGLVVVRDLLLVGGAVYKR
ASSLGWKWNSWSDFVNLDAIHREKVKPLFISKVNTVFQLMLVAAALLQPEFGTEETQNYI
TVLSWLVASTTIASTVGYGIKYRQIRPRR
NT seq 990 nt   +upstreamnt  +downstreamnt
atggcgttcctcaaaaccctgaaccctctcctccgcagaagccccaccccgatcccgaac
ccccgctccctcctttccctcgacgccttcctcgccgcctcctcccccaccgccgcctcc
cacgccaccgcgcccgcgcccttcgccgccgcggcgcaccaccacgtccccatccgctcg
gggggcccgctgttcctctcctcgccgccatggatgctctcccagtccgccacgccgctc
accgccgcggccgccgctctccgcgccaggctccggagggcccgcgcgctcgccggcggc
ggcgcccaggctgtcgcggacgccgtagggtgggagcccaggcggatctccagagatgag
agcgaggtggcggaggcggtgacgggtggaagggagaggttcctgaatctgcccaatctg
gtgtcgattggacgcatggcgtcggggccggttattggatggatgattgtgaatgaatgg
tatcttcctgcttttggcacattggctttgtctggtgcaagtgattggttagatggcttt
ttagcgagaaagatgggcatcaattctgtgtttggatcttatctggacccattagctgat
aaggtgttgattggctgtgttgccatagcaatggttgaaaaagacctcttacatcctggg
cttgttggcttggttgttgtaagagacttgctccttgtgggtggtgctgtctacaaacga
gcttccagtctgggatggaagtggaacagttggtcagactttgttaacttagatgcaatt
caccgtgagaaggtcaaacctctttttatcagcaaggtgaacacagttttccaattgatg
ttggttgctgctgctctcctccagccagaatttggcacagaggagactcagaattatatt
acagtgttgagctggcttgtagcttctacaacaattgcatccacagtaggttatggtatc
aaatatcgtcagattagaccaagaagatga

DBGET integrated database retrieval system