KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325932
Entry
4325932           CDS       T01015                                 
Name
(RefSeq) glycine dehydrogenase (decarboxylating), mitochondrial
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4325932
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4325932
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     4325932
SSDB
Motif
Pfam: GDC-P Beta_elim_lyase
Other DBs
NCBI-GeneID: 4325932
NCBI-ProteinID: XP_015613492
UniProt: Q0JJW8 Q6V9T1
LinkDB
Position
1:29560209..29566768
AA seq 1033 aa
MERARRLANRALLRRLLAAAASTTSPAPSRGISTLAKAPGAGSRPRAPRPAPHQYTTGRP
VSASALQPSDTFPRRHNSATPAEQAAMASECGFNTLDALIDATVPAAIRAPTMHFSGKFD
AGFTESQMIDHMQRLAAMNKAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQAEI
AQGRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGILKSKKKTFLIASNCH
PQTIDVCQTRAAGFDLNVIVADAKDFDYSSGDVCGVLVQYPGTEGEVLDYAEFVKDAHAH
GVKVVMATDLLALTSLRPPGEIGADIAVGSAQRFGVPMGYGGPHAAFLATSQEYKRLMPG
RIIGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKA
IADRVHGLAGTFAHGLKKLGTVTVQELPFFDTVKVKVADANAIAQEACKNEMNLRVVDAT
TITVAFDETTTLEDVDKLFKVFNGGKPVNFTAESLASEVSSSIPSSLVRKSPYLTHPIFN
MYHTEHELLRYLHKLQSKDLSLCHSMIPLGSCTMKLNATVEMMPVTYPSFANMHPFAPTE
QAAGYHEMFDDLGDLLCKITGFDSFSLQPNAGASGEYAGLMVIRAYHRARGDYHRDVCII
PVSAHGTNPASAAMCGMKIVAVGTDSKGNINIEELRKAAEANKDNLAALMVTYPSTHGVY
EEGIDEICRIIHENGGQVYMDGANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPG
MGPIGVKKHLAPFLPSHPVITTGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGS
KGLTDASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAK
RLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNN
VLKSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQ
GSQVAEEAAAATA
NT seq 3102 nt   +upstreamnt  +downstreamnt
atggagcgcgcacgccgcctcgccaaccgcgccctgctgcgccgcctcctcgcggcggcg
gcgtccaccacgtccccggccccgtcccgcggcatctcgaccctggccaaggcgcccggg
gcggggtcgcgcccgcgcgccccgcgcccggcgccccaccagtacaccacggggcggccc
gtgtcggcgtcggcgctgcagccgagcgacacgttcccgcggaggcacaactcggccacg
ccggcggagcaggcggcgatggcgtcggagtgcgggttcaacaccctcgacgcgctcatc
gacgccaccgtcccggccgccatccgcgcgccgacgatgcacttctccgggaagttcgac
gccgggtttaccgagtcccagatgattgaccacatgcagcgcctggcggccatgaacaag
gcctacaagtccttcatcgggatggggtactacaacacccacgtccccgcggtgatactg
cgcaacctcatggagaaccccgcgtggtacacgcagtacacgccgtaccaggcggagatc
gcgcagggccgtctcgagtcgctgctcaactaccagaccatggtcgccgacctcaccggc
ctgcccatgtccaacgcctcgctgcttgacgaggccaccgccgccgccgaggccatggcc
atgtgcaacggcatcctgaaatccaagaagaagaccttcctcatcgcctccaactgccac
ccgcagaccatcgacgtctgccagacgcgcgccgctgggttcgacctcaacgtcatcgtc
gcggacgccaaggacttcgactacagcagcggtgatgtgtgcggagtgctcgtgcagtac
cccggcacggagggggaggtgctggactacgcggagttcgtcaaggacgcgcacgcgcac
ggcgtcaaggtggtcatggccaccgacctgctcgcgctcacctcgctgcgcccgcccggt
gagatcggcgccgacatcgccgtcggctccgcgcagcggttcggcgtgcccatggggtac
ggaggcccgcacgccgcgttcctcgccacttcccaggagtacaagcgcctcatgcccggc
cgtatcatcggcgtgagcgtcgattccagcggcaagcccgcgctccggatggcgatgcag
acccgggagcagcacatccgccgcgacaaggccaccagcaacatctgcactgcccaggcc
ttgctcgccaacatggcagcgatgtatgctgtctaccatggtcccgaggggctaaaggca
attgccgaccgtgtacacggcctggctggtacctttgcccatggactgaagaagctcgga
acagtgactgtgcaggaactgccgttctttgacactgtcaaggtcaaggtcgctgatgcg
aatgcgattgcccaggaggcctgcaagaacgagatgaaccttcgtgttgttgatgcaacc
acgataaccgtggcctttgatgagaccacaaccttagaggatgtcgacaagctgttcaag
gtgttcaatggtggcaagccagtgaacttcactgctgaatccctcgcatcagaggtgtca
agctcaattccgagtagccttgtgcgcaagagcccctacttaacacacccgatctttaac
atgtaccatacagagcacgagcttctccgatacctgcacaagttgcaatccaaggatctt
tcactgtgccacagtatgatccctcttggttcttgcactatgaaactaaatgctacagtg
gagatgatgcccgtcacctaccccagctttgcaaacatgcacccatttgcacctactgaa
caagccgcaggatatcatgaaatgtttgatgacttgggcgatctgctgtgcaagatcact
ggctttgattctttctctttgcaaccaaatgctggtgcatcaggggagtatgccggattg
atggttatccgtgcttaccacagggcaagaggagactaccaccgggacgtctgtatcatt
cctgtgtcagcccatggtacaaatcctgcaagtgctgctatgtgtggaatgaagatcgtt
gctgttggaactgattccaaaggtaacattaacatcgaggagttgaggaaagctgctgaa
gcaaacaaggacaacttggctgctcttatggttacctatccttcgacccatggagtctat
gaagaaggcattgatgagatatgcaggataattcatgagaacggtgggcaggtatacatg
gatggggctaacatgaatgctcaggtcggattgacaagccctggctttattggagcagat
gtttgccaccttaaccttcacaagacattctgcattccacatggtgggggtggtcctgga
atgggtcctattggtgttaagaagcacttagcaccatttttaccatctcatccagtgatc
accactggtggcttccctctccctgagaaaaccgaccctcttggtaccatttctgctgcc
ccatggggatcagcgttgattctgccaatttcctacacatacatagccatgatgggttct
aagggtctcactgatgcttcaaagattgcaatcttgaatgcaaactacatggcaaagcgt
ctggagaaacactacccagttcttttccgtggagtcaatggaactgttgcccatgaattc
atcattgatttaagaggatttaagacgactgctggtatagagccagaggatgttgcaaag
cgtttgatggactatggattccatgcacctactatgtcatggcctgttccaggcacactt
atgattgaacccactgaaagtgaaagcaaggccgaactagacaggttctgtgatgctcta
atctcaatcagggaagaaattgcagaaatcgaaagtggcaaagcagatgtgaacaacaat
gtcctcaagagtgctcctcacccgccccaacttctgatgagcgactcatggactaagccg
tactccagggagtacgctgcgttccctgcagcgtggcttcggggcgccaagttctggcca
acaacatgtcgcgtggacaatgtgtatggggatcgcaacctcatctgcactctgcaacag
ggatcccaagtcgcagaagaagctgcagctgctaccgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326849
Entry
4326849           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyl dehydrogenase 1, chloroplastic
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00260  Glycine, serine and threonine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4326849
   00020 Citrate cycle (TCA cycle)
    4326849
   00620 Pyruvate metabolism
    4326849
   00630 Glyoxylate and dicarboxylate metabolism
    4326849
   00640 Propanoate metabolism
    4326849
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4326849
   00280 Valine, leucine and isoleucine degradation
    4326849
   00310 Lysine degradation
    4326849
   00380 Tryptophan metabolism
    4326849
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326849
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     4326849
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4326849
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_binding_2 GIDA FAD_oxidored Lys_Orn_oxgnase Pyr_redox_3 Thi4 UDPG_MGDP_dh_N DAO
Other DBs
NCBI-GeneID: 4326849
NCBI-ProteinID: XP_015625013
UniProt: A0A0N7KCW5 Q94CN9
LinkDB
Position
1:13272604..13282036
AA seq 561 aa
MYSTAISLSAAATAAAAVGGARPGAIRPAELRFCGLRREALGLRSLRAPPRAAATPRKAA
AATGNGAAGSGGFDYDLVIIGAGVGGHGAALHAVEKGLKTAIIEGDVVGGTCVNRGCVPS
KALLAVSGRMRELQDEHHMKSLGLQVSTAGYDRQAVADHANNLASKIRSNLTNSMKALGV
DILTGFGTIVGKQKVRYGKVGFPDNEITARNIIIATGSVPFVPNGIEIDGKTVFTSDHAL
KLESVPDWIAIVGSGYIGLEFSDVYTALGSEVTFVEALDQLMPGFDPEIAKLAQRILINP
RKIDYHTGVFASKITPAKDGKPVLIELIDAKTKEHKETLEVDAALIATGRAPFTKGLGLE
NVNVVTQRGFVPVDERMQVMDADGNAVPNLYCIGDANGKLMLAHAASAQGISVVERISGK
DNILNHLSIPAACFTHPEISMVGLTEPQAREKADKEGFEISVVKTSFKANTKALAENEGD
GLAKMIYRPDTGEILGVHILGLHAADLIHEASNAIALGTRVQDIKFAVHAHPTLSEVLDE
LFKAAKVNAGVPHSVNEPVAA
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgtactccacggctatctcgctctccgccgccgccaccgccgccgcggcggtcggcggc
gcccggccaggcgcgatccggccggcggagctccgcttctgcggcctccgccgcgaggcc
ctcgggctccgctcgctgcgggccccgccgcgagcggccgccacgccgcggaaggcggcg
gcggctactgggaatggtgcggccgggagcggcgggttcgactacgacctcgtgatcatt
ggggcgggcgtcggcgggcacggcgcagctctccacgccgtcgagaagggtctgaaaact
gccataattgagggggatgttgtaggtgggacttgtgtgaacagaggttgtgttccgtcg
aaggcacttcttgctgtcagcggtcggatgagggaacttcaagatgaacaccacatgaaa
tcgttgggtctacaggtttcaacagctggatatgataggcaggctgttgcagatcatgca
aataatctggcctctaaaattcgtagcaacttgactaattcgatgaaagctttgggtgtg
gatatattgactggttttggcaccattgtgggaaaacaaaaagtgagatatggaaaagtt
ggttttcctgacaatgaaatcactgccagaaatatcattattgcaacggggtctgttcct
tttgtccccaatggcatcgaaatagatggtaaaaccgtatttactagtgatcatgcacta
aaacttgagtcagttcctgactggattgctatcgtgggaagcggttacattggactggaa
ttcagtgatgtatacacggctctgggaagtgaggttacttttgttgaagcacttgatcag
ttgatgcctggttttgatcctgagattgcaaaattggcccaaaggattcttatcaatcct
cgtaaaattgactatcatactggggtctttgcgagcaagattaccccagcaaaggatggt
aaacccgtgttgattgagttaattgatgctaagacaaaggaacacaaggaaacacttgag
gtggatgcagctctcatagctaccggaagggcaccgttcaccaaagggcttggcttggaa
aatgtcaacgttgttacacaacgcggttttgttcctgttgatgagcggatgcaagttatg
gacgcagatggcaatgcggttccaaatttgtattgtattggagatgccaatggcaaactc
atgctggctcatgctgccagtgcacaaggaatctcagttgttgagcgaatctctgggaaa
gacaacatcctaaatcatctaagcatcccggctgcctgtttcactcatccggagattagt
atggttgggctaacagagccacaagcgagagaaaaggctgataaggaaggatttgagata
agtgttgttaagaccagcttcaaggcaaacacgaaggctctggctgagaatgaaggagat
ggacttgctaagatgatttaccggcctgacactggagaaattcttggagttcacatatta
ggtttgcatgctgctgacctcatccacgaggcatcaaacgccattgccctcggaactcgt
gtacaagacatcaagtttgctgttcatgcacacccaactttgtctgaggttctggatgag
ctcttcaaagctgccaaggttaatgcaggtgttcctcattccgtaaatgagcccgtcgca
gcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326980
Entry
4326980           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyl dehydrogenase 1, mitochondrial
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00260  Glycine, serine and threonine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4326980
   00020 Citrate cycle (TCA cycle)
    4326980
   00620 Pyruvate metabolism
    4326980
   00630 Glyoxylate and dicarboxylate metabolism
    4326980
   00640 Propanoate metabolism
    4326980
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4326980
   00280 Valine, leucine and isoleucine degradation
    4326980
   00310 Lysine degradation
    4326980
   00380 Tryptophan metabolism
    4326980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326980
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     4326980
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4326980
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored Pyr_redox_3 GIDA FAD_binding_2 NAD_binding_8 AlaDh_PNT_C DAO Thi4 HI0933_like 3HCDH_N FAD_binding_3 UDPG_MGDP_dh_N Lycopene_cycl Trp_halogenase
Other DBs
NCBI-GeneID: 4326980
NCBI-ProteinID: XP_015611017
UniProt: A0A0P0V236
LinkDB
Position
1:complement(12654851..12658470)
AA seq 503 aa
MALAILARRRAAEALLRRPLGAAGVSALRASYAAVAGEESDVVVVGGGPGGYVAAIKAAQ
LGLKTTCIEKRGTLGGTCLNVGCIPSKALLHSSHMYHEAKSSFAHHGVKFSNLEVDLPAM
MAQKDKAVAGLTKGIEGLFKKNKVTYVKGFGKLASPSEVSVDLSDGGSTVVKGKNIIIAT
GSDVKSLPGVTIDEKKIVSSTGALCLSEIPKKLVVIGAGYIGLEMGSVWNRLGSEVTVVE
FAPDIVPSMDGEVRKQFQRMLEKQKMKFMLKTKVVGVDTSGDGVKLTLEPAAGGEQSVIE
ADIVLVSAGRVPYTAGIGLESVGVETDKAGRILVDKRFMTNVNGVYAIGDAIPGPMLAHK
AEEDGVACVEFIAGKEGHVDYDTVPGVVYTHPEVASVGKTEEQVKALGIPYRVGKFPLLA
NSRAKAIDDAEGLVKVVAEKETDKILGVHIMAPGAGEIIHEAVLALQYGASSEDIARTCH
AHPTVSEALKEACLQTFTKAIHI
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcgctcgcaatcctggcgaggaggcgggcggcggaggcgctgctgcggcggccgctg
ggggcggcgggggtgtcggcgctgagggcgtcgtacgcggcggtggcgggggaggagagc
gacgtggtggtggtgggcggcgggccgggagggtacgtggcggcgatcaaggcggcgcag
ctggggctcaagaccacctgcatcgagaagaggggcaccctcggcgggacatgcctcaac
gtcggctgcatcccctccaaggctctgttgcactcatctcatatgtaccatgaagcaaaa
agttcctttgcacaccatggagtgaaattttccaatctggaggtagacctcccagctatg
atggcacagaaagacaaggctgtggcaggcctgactaaggggattgaaggtctcttcaag
aagaacaaagtgacgtatgtcaaaggctttgggaaacttgcttcgccctcagaggtgtct
gttgatctgagcgatggtggcagcacagttgtcaaagggaaaaacataatcattgctaca
gggtctgatgtaaaatcactccctggagtcacaattgatgagaagaaaatcgtctcatct
actggggccttgtgcttgtcagagattccaaagaaattggtggttattggagcaggttac
attggtctggagatgggttcggtctggaaccgccttggttcagaggtcaccgttgttgaa
tttgccccagatatagttccatcaatggatggtgaagtcaggaagcagttccagcgcatg
ttggagaagcagaagatgaagttcatgctcaagacaaaggtagttggggttgatacctcc
ggagatggtgtgaagctaacacttgaacctgcagctggaggtgagcagagtgtcattgaa
gctgatattgtattggtttctgctggaagagtcccatatactgctggtattgggttggaa
agtgttggtgttgagacagacaaagctggcaggatcctcgtggataagcgcttcatgact
aacgtcaatggagtctatgcaattggggatgccatccctgggcccatgcttgcccacaaa
gctgaagaggatggtgttgcctgtgttgagttcattgctggcaaggaggggcacgtcgac
tatgacacagtgcctggtgtggtctatacacatccagaggtcgcgtctgttggaaagact
gaagagcaggtgaaagctttaggaattccctaccgtgttggcaaatttccgctgttggca
aacagccgtgcaaaggccattgacgatgctgagggcttggtgaaggtggtggctgagaag
gaaactgacaagattctgggcgtgcatatcatggctcccggtgctggagagataatacat
gaggctgtccttgctttgcagtatggagcatcaagtgaggacatagctcgtacatgccac
gctcatcccaccgtgagcgaagccttgaaggaggcctgcctgcaaaccttcacaaaggcg
attcacatttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328441
Entry
4328441           CDS       T01015                                 
Name
(RefSeq) glycine cleavage system H protein 2, mitochondrial
  KO
K02437  glycine cleavage system H protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4328441
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4328441
SSDB
Motif
Pfam: GCV_H Biotin_lipoyl RnfC_N
Other DBs
NCBI-GeneID: 4328441
NCBI-ProteinID: XP_015627588
UniProt: Q6H713 Q0E3J8
LinkDB
Position
2:3827679..3830123
AA seq 158 aa
MAMAASRLLWASRAASYLKISTFPRAFSTVLKDLKYADTHEWVKVEGDSATVGITDHAQH
HLGDVVYVELPEVGSSVSQGKNFGAVESVKATSDIYSPVSGEVVAVNDGLGDEPGLVNTS
PYESGWIIKVKVSDSGELNSLMDDAKYSKFCEEEDSKH
NT seq 477 nt   +upstreamnt  +downstreamnt
atggccatggccgcctccaggttgctgtgggcttcccgcgccgcctcctacctcaagatc
tccactttccccagggccttctccaccgtgctgaaggatctgaagtatgctgacactcat
gaatgggttaaggttgagggtgattcggcaaccgttggaattacagaccatgcccagcac
catttgggtgatgttgtgtatgtggagcttccagaagttggcagcagtgtatcccaggga
aagaactttggtgctgttgaaagtgtgaaggcaaccagcgatatctactctccagtatct
ggagaggtggttgcagtgaacgatggactaggcgatgaacctggattggttaatacaagt
ccatacgagagtgggtggatcatcaaggtcaaggttagtgattcaggtgagctcaattca
ttgatggatgacgcgaaatactcgaaattctgcgaggaagaagatagcaagcattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337051
Entry
4337051           CDS       T01015                                 
Name
(RefSeq) aminomethyltransferase, mitochondrial
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00670  One carbon pool by folate
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4337051
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4337051
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    4337051
Enzymes [BR:osa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     4337051
SSDB
Motif
Pfam: GCV_T GCV_T_C
Other DBs
NCBI-GeneID: 4337051
NCBI-ProteinID: XP_015635501
UniProt: Q0J9Z5 Q7XPR2
LinkDB
Position
4:31700840..31703597
AA seq 408 aa
MRGLLACATLARRAAGATSTARRHLAGAAEAAEAELKKTALYDFHVAHGGKMVPFAGWSM
PIQYKDTIMDSTLNCRANGSLFDVSHMCGLSLHGRQAIPFLESLVVADVAALKDGTGTLT
VFTNDRGGAIDDSVVTKVTDQHIYLVVNAGCRDKDLAHIGEHMEAFNKKGGDVKWHVHDE
RSLLALQGPLAAPTLQLLTKEDLSKMYFSDFKMIDINGYACFLTRTGYTGEDGFEISVPS
ENAVDLAKALLEKSEGKVRLTGLGARDSLRLEAGLCLYGNDMEQHITPVEAGLSWAIGKR
RKAEGGFLGADVILKQLQEGPKIRRVGLLSQGPPPRSHSEIVSNSGENIGEVTSGGFSPC
LKKNIAMGYVKSGLHKAGTEFKVVVRGKSYDAVVTKMPFVPTKYYKPS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgagagggctactcgcgtgcgccacgctcgcccgccgcgccgccggcgcgacgtcgacg
gcgcggcggcacctggcgggcgcggccgaggcggcggaggcggagctgaagaagacggcg
ctgtacgacttccacgtcgcgcacggcgggaagatggtgccgttcgccgggtggagcatg
cccatccagtacaaggacaccatcatggactccaccctcaactgccgcgccaacggcagc
ctcttcgacgtctcccacatgtgcggcctcagcctccacggccgccaggccatccccttc
ctcgagtccctcgtcgtcgccgacgtcgcggcgctcaaggacggcaccgggacgctcacc
gtcttcaccaacgaccgcggcggcgccatcgacgactccgtcgttaccaaggtcaccgac
cagcacatctacctcgtcgtcaacgccgggtgcagggacaaggatctcgcccacattggg
gagcacatggaggccttcaacaagaagggcggcgacgtcaagtggcacgtccacgatgag
cgctcgcttcttgcattgcagggacctcttgctgcaccaactctccagttgctgacaaaa
gaagatttaagcaaaatgtatttcagtgacttcaagatgattgacatcaatggatatgct
tgctttctcaccagaactggttataccggtgaagatgggtttgaaatctctgttccatca
gagaatgcagttgatcttgcaaaggccctcctggagaaatctgaaggcaaggtgagactg
actggtttaggtgcccgtgacagtctccgcttggaggctggcctctgcctgtacggcaac
gacatggagcaacacatcacaccagttgaggctggtctctcatgggcaattggcaagagg
aggaaagcagaaggcggcttcctgggagcagatgtgatcctcaagcagctccaggaaggc
ccaaagatcaggcgtgtcggtctcctctcgcaaggaccgcctcctcggagtcatagtgag
attgtgagcaactccggggagaacattggtgaggttaccagtggagggttcagcccctgc
ttgaagaagaacatcgccatgggctacgtaaaatccggtttgcacaaggctgggacagag
ttcaaggttgtcgtccgtgggaagtcctacgatgccgtcgtcaccaagatgccgttcgtg
ccgaccaagtactacaaaccctcatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337862
Entry
4337862           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyl dehydrogenase 1, chloroplastic
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00260  Glycine, serine and threonine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4337862
   00020 Citrate cycle (TCA cycle)
    4337862
   00620 Pyruvate metabolism
    4337862
   00630 Glyoxylate and dicarboxylate metabolism
    4337862
   00640 Propanoate metabolism
    4337862
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4337862
   00280 Valine, leucine and isoleucine degradation
    4337862
   00310 Lysine degradation
    4337862
   00380 Tryptophan metabolism
    4337862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337862
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     4337862
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4337862
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_binding_2 FAD_oxidored GIDA Lys_Orn_oxgnase Thi4 Pyr_redox_3 UDPG_MGDP_dh_N DAO STALD
Other DBs
NCBI-GeneID: 4337862
NCBI-ProteinID: XP_015637430
LinkDB
Position
5:complement(3313369..3319855)
AA seq 567 aa
MNSAAAAAACASAPAWVVGGGAGGGARSARGPCGIRVCGLGGEAVALRSLRISQGAAVRR
AAVAARAAAENGVAGSGGFDYDLVIIGAGVGGHGAALHAVEEGLKTAIIEGDVVGGTCVN
RGCVPSKALLAVSGRMRELHDEHHMKSLGLQVSSPGYDRQAVADHANNLASKIRSNLTNS
MKALGVDILSGFGAIVGKQKVRYGKVGFPDKEITARNIIIATGSVPFVPKGIEVDGKTVF
TSDHALKLESVPDWIAIVGSGYIGLEFSDVYTALGSEVTFVEALDQLMPGFDPEIAKLAQ
RVLINPRNIDYHTGVFASKITPAKDGKPVQIELIDAKTKEHKETLEVDAALIATGRAPFT
KGLGLENINVVTQRGFIPVDERMRVMDADGNVVPNLYCIGDANGKLMLAHAASAQGISVV
EQISGRDHILNHLSIPAACFTHPEISMVGLTEPQAREKADKEGFEISVVKTSFKANTKAL
AENEGDGLAKLIYRPDTGEILGVHILGLHAADLIHEASNAIALGTRLQDIKFAVHAHPTL
SEVLDELFKAAKVNSGVSHSVNEPVAA
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgaactccgcggcggcggcggcggcgtgcgcctcggccccggcgtgggtggtcggcggc
ggcgccggcgggggagccagatccgcgcgggggccatgcgggatcagggtgtgcgggctc
gggggcgaggcggtggcgctccgctcgctgcggatctcgcagggggcggcggtgaggcgg
gcggcggtggcggcgagggcggccgcggagaacggcgtggcggggagcggcgggttcgac
tacgacctcgtcatcatcggcgccggcgttggtgggcacggcgcggcgctccacgctgtc
gaggagggtttgaaaactgcaattattgagggagatgttgtaggtgggacttgtgtaaac
agaggttgtgtcccatcaaaagcacttcttgctgtcagcggtcgcatgagggagcttcat
gatgaacatcacatgaagtcattgggtctacaggtttcatcccctggatatgacagacaa
gctgttgctgatcatgcaaacaatctcgcctctaaaatccgaagcaacttgactaattca
atgaaagctctgggagtggatatattgagtggttttggtgcaattgttggaaaacaaaag
gtacggtatggaaaagttggttttccagacaaagaaatcactgcaaggaatatcatcatt
gctactggatcagttccttttgttcccaagggcatagaggttgatgggaaaactgttttt
accagtgatcatgcactaaaacttgagtctgtcccggactggatagcaatcgttggaagt
ggatacattgggcttgaattcagtgatgtatatacagctcttggaagtgaggttactttt
gttgaagctcttgaccagctaatgcctggttttgatcctgaaattgcaaaattagcccag
agagtccttatcaaccctcggaatatagactatcacactggtgtttttgcaagcaagatt
actccagcaaaggatggaaaacctgtgcagattgagctcattgatgcaaaaacaaaggaa
cacaaagaaaccctcgaggtggatgcagcccttatagccacaggacgggcaccattcaca
aaaggacttggcttggaaaatatcaatgttgttacacagcgtggttttattcctgttgat
gagcgaatgcgagtcatggatgcagatggcaatgtggttccgaacttatattgcattgga
gatgccaatggtaaactcatgcttgctcatgctgccagtgcacagggaatctctgttgtc
gaacaaatctctgggagggaccacatcctaaatcatttaagcatccccgctgcttgcttc
actcatccagagattagtatggttgggcttacagagccacaagccagagaaaaagctgat
aaagaaggatttgagataagtgttgttaagaccagctttaaggctaatacaaaagcattg
gcagaaaatgaaggagatggacttgctaagttgatttaccggcctgacactggagaaatt
cttggtgtgcacattttgggtttgcacgctgctgacctcatccacgaggcatcaaatgcc
attgccctaggaactcggttgcaagacatcaagtttgctgttcatgcacacccaacattg
tccgaggtgctggacgaactctttaaagcagccaaggttaattcgggtgtttctcattct
gtaaatgaaccagttgcagcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337881
Entry
4337881           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyl dehydrogenase, mitochondrial
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00260  Glycine, serine and threonine metabolism
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4337881
   00020 Citrate cycle (TCA cycle)
    4337881
   00620 Pyruvate metabolism
    4337881
   00630 Glyoxylate and dicarboxylate metabolism
    4337881
   00640 Propanoate metabolism
    4337881
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4337881
   00280 Valine, leucine and isoleucine degradation
    4337881
   00310 Lysine degradation
    4337881
   00380 Tryptophan metabolism
    4337881
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337881
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     4337881
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   4337881
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_oxidored FAD_binding_2 NAD_binding_8 AlaDh_PNT_C DAO Thi4 HI0933_like FAD_binding_3 UDPG_MGDP_dh_N 3HCDH_N Lys_Orn_oxgnase Lycopene_cycl
Other DBs
NCBI-GeneID: 4337881
NCBI-ProteinID: XP_015639335
LinkDB
Position
5:3526771..3530399
AA seq 504 aa
MAMASLARRRAAEAALLRRAPAAAWASAWRGYAAAAAGEESDVVVIGGGPGGYVAAIKAA
QLGLKTTCIEKRGTLGGTCLNVGCIPSKALLHSSHMYHEAKASFAHHGIKFSNLEIDLPA
MMSQKDKAVAGLTKGIEGLFKKNKVEYVKGFGKFVSPSEVSVDLLDGGSTTVKGKNIIIA
TGSDVKSLPGVTIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVWNRLGSEVTVV
EFASDIVPSMDGEIRKQFQRMLEKQKMKFMLKTKVVGVDTSGSGVKLTVEPAAGGEQSVL
ECDIVLVSAGRVPYTSGLGLNALGVETDKGGRILVDKRFMTNVKGVYAIGDAIPGPMLAH
KAEEDGVACVEFIAGKEGHVDYDTVPGVVYTHPEVASVGKTEEQVKASGVAYQVGKFPLL
ANSRAKAIDDAEGLVKVVAEKETDRILGVHIMAPNAGEIIHEAVLALQYGASSEDIARTC
HAHPTVSEALKEACLQTYLKAIHI
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcgatggcgagcttggcgaggaggcgcgcggcggaggcggcgctgctgcggcgggcg
ccggcggcggcgtgggcgtccgcgtggagggggtacgcggcggcggcggcgggggaggag
agcgacgtcgtggtgatcggcggcgggccgggcgggtacgtggccgccatcaaggcggcg
cagctagggctcaagaccacctgcatcgagaagaggggaacgctcgggggcacctgcctc
aacgtcggctgcatcccctccaaggctctcctgcattcgtcgcatatgtaccatgaggcc
aaggcttcttttgcacaccatggtatcaaattctcaaatcttgaaatagatttgcctgcc
atgatgtcacagaaagacaaagcagttgctgggctgactaaagggattgaaggcctgttc
aagaagaacaaggttgagtatgtcaaaggatttggaaagtttgtgtccccttcagaggta
tctgttgacttgctcgatggtggtagcactactgttaaagggaagaacataatcattgcc
actggctcagatgtgaaatcactccctggagttacaatagatgagaagaagatcgtgtca
tctactggtgctcttgctctttcagaaataccaaagaagttggtggttattggagctgga
tacattggtttagagatgggttctgtctggaacaggctagggtctgaggtcactgtcgtt
gaattcgcttctgacattgtcccgtcaatggatggagagattaggaagcagttccagcgt
atgctggagaagcagaaaatgaagttcatgcttaagacaaaagttgttggggttgatacc
tctgggagtggtgtcaagttaactgtggagcctgcagctggtggagagcagagtgttctt
gagtgtgatattgttcttgtatctgctggcagagtaccatacacctctggtcttggattg
aacgcccttggtgttgagactgacaagggtggaagaatccttgtcgacaagcgctttatg
acaaatgttaagggtgtttatgcgattggagatgcgatccctggacccatgcttgcacat
aaagctgaagaagatggtgttgcctgtgttgaattcatcgcaggtaaagaaggtcacgta
gattatgacactgtacctggagtggtgtacacacacccagaggtggcttctgttgggaag
acggaagaacaggtcaaggcatcaggagtggcctaccaggttgggaagttccccctgttg
gccaacagccgtgcaaaggcaattgatgatgctgaagggttggtcaaggtagtggctgag
aaggagaccgatagaatcctcggtgtacatataatggcccctaatgcaggtgagataatc
catgaggcggtgcttgcacttcagtatggagcatctagtgaggatattgcacggacatgc
catgcgcatccaacagtgagcgaagccctgaaggaggcttgcctacagacctacctgaag
gcgattcacatttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341516
Entry
4341516           CDS       T01015                                 
Name
(RefSeq) glycine dehydrogenase (decarboxylating), mitochondrial
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4341516
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4341516
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     4341516
SSDB
Motif
Pfam: GDC-P Beta_elim_lyase
Other DBs
NCBI-GeneID: 4341516
NCBI-ProteinID: XP_015643657
UniProt: Q69X42
LinkDB
Position
6:complement(24399594..24406045)
AA seq 1031 aa
MERARRLANRALLRRLLAAATAESPAAPSRGISTLAKGSRPRAPPRPAPHQYTTGRRPVS
ASALQPSDTFPRRHNSATPAEQAAMASECGFGTVDALIDATVPAAIRAPEMRFSGRFDAG
FTESEMIEHMQRLAAMNRAYKSFIGMGYYNTHVPAVILRNLMENPAWYTQYTPYQAEIAQ
GRLESLLNYQTMVADLTGLPMSNASLLDEATAAAEAMAMCNGILKSKKKTFLIASNCHPQ
TIDVCQTRAAGFDLNVVVADAKDFDYGSGDVCGVLVQYPGTEGEVLDYAEFVRDAHAHGV
KVVMATDLLALTSLRPPGEIGADIAVGSAQRFGVPMGYGGPHAAFLATSQEYKRLMPGRI
IGVSVDSSGKPALRMAMQTREQHIRRDKATSNICTAQALLANMAAMYAVYHGPEGLKAIA
DRVHGLAGTFAQGLKKLGTVTVQELPFFDTVKVKVADANAIAQEACKNEMNLRVVDATTI
TVAFDETTTLEDVDKLFKVFNGGKPVNFTAESLAPEVSSSIPSSLVRKSPYLTHPIFNMY
HTEHELLRYLYKLQSKDLSLCHSMIPLGSCTMKLNATVEMMPVTYPNFANMHPFAPTDQA
AGYHEMFDDLGDLLCKITGFDSFSLQPNAGASGEYAGLMVIRAYHRARGDYHRDVCIIPV
SAHGTNPASAAMCGMKIVAVGTDSKGNINIEELRKAAEANKDNLAALMVTYPSTHGVYEE
GIDEICMIIHENGGQVYMDGANMNAQVGLTSPGFIGADVCHLNLHKTFCIPHGGGGPGMG
PIGVKKHLAPFLPSHPVITTGGFPLPEKTDPLGTISAAPWGSALILPISYTYIAMMGSKG
LTDASKIAILNANYMTKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRL
MDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVL
KSAPHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGS
QVAEEAAAATA
NT seq 3096 nt   +upstreamnt  +downstreamnt
atggagcgcgcacgccgcctcgccaaccgcgcgctgctgcgccgcctcctcgcggcggcg
acggcggagtccccggcggccccgtcccgcggcatctcgaccctggccaaggggtcgcgc
ccgcgcgcccccccacgcccggcgccccaccagtacaccacggggcggcggcccgtgtcg
gcgtcggcgctgcagccgagcgacacgttcccgcggcggcacaactcggcgacgccggcg
gagcaggcggcgatggcgtcggagtgcgggttcggcaccgtcgacgcgctcatcgacgcc
accgtcccggccgccatccgcgcgccggagatgcgcttctccgggaggttcgacgccggg
ttcaccgagtccgagatgatcgagcacatgcagcgcctcgccgccatgaacagggcctac
aagtccttcatcgggatggggtactacaacacccacgtccccgcggtgatcctgcgcaac
ctcatggagaacccggcgtggtacacgcagtacacgccgtaccaggcggagatcgcgcag
ggtcgcctcgagtcgctgctcaactaccagaccatggtcgccgacctcaccggcctcccc
atgtccaacgcctcgctgctcgacgaggccaccgccgccgccgaggccatggccatgtgc
aacggcatcctcaagtccaagaagaagaccttcctcatcgcctccaactgccacccgcag
accatcgacgtgtgccagacgcgcgccgccgggttcgacctcaacgtcgtcgtcgcggac
gccaaggacttcgactacggcagcggcgacgtgtgcggggtgctcgtgcagtaccccggc
acggagggggaggtgctggactacgcggagttcgtcagggacgcgcacgcgcacggcgtc
aaggtggtcatggccaccgacctgctcgcgctcacctcgctgcgcccgcccggcgagatc
ggtgccgacatcgccgtcggctccgcgcagcggttcggcgtgcccatggggtacggcggc
ccgcacgccgcgttcctcgccacgtcccaggagtacaagcgcctcatgcccggccgcatc
atcggcgtcagcgtcgattccagcggcaagcccgcgctccggatggcgatgcagacccgg
gagcagcacatccgccgcgacaaggccaccagcaacatctgcactgcccaggccttgctc
gccaacatggcagcgatgtatgctgtctaccatggtcccgaggggctaaaggcaattgcc
gaccgtgtacatggactggctggtacatttgcccaaggattgaagaagctcggaacagtg
acggtgcaggagctgcccttcttcgacactgtcaaggtcaaggtcgctgacgcgaatgcg
attgcccaggaggcctgcaagaacgagatgaaccttcgtgtcgttgatgcaaccacgata
accgttgcctttgatgagaccacaaccttggaggatgtcgacaagctgttcaaggtgttc
aatggtggcaagccagtgaacttcactgctgaatccctcgcaccagaggtctcaagctca
attccgagtagccttgtgcgcaagagcccctacttaacccacccgatctttaacatgtac
catacagagcatgagcttctccgctacctgtacaagttgcaatccaaggacctttcactg
tgccacagtatgatccctcttggttcttgcactatgaaactaaatgctacagtggagatg
atgcctgtcacctaccccaactttgcaaacatgcacccatttgcacctactgaccaagcc
gcaggatatcatgaaatgtttgatgacttgggcgatctgctgtgcaagatcactggcttt
gattctttctctttgcaaccaaatgctggtgcttcaggggagtatgccggattgatggtt
atccgtgcttaccacagggcaagaggagactaccaccgggatgtctgtatcattcctgtg
tcagcccatggtacaaatcctgcaagtgctgctatgtgtggaatgaagattgttgctgtt
ggaactgattccaaaggtaacattaacatcgaggagttgaggaaagctgctgaagcaaac
aaggacaacttggctgctcttatggttacctatccttcgacccatggagtctatgaagaa
ggcattgatgagatatgcatgataattcatgagaacggtgggcaggtctacatggatgga
gctaacatgaatgctcaggtcggattgacaagccctggctttattggagcagatgtttgc
caccttaaccttcacaagacattctgcattccacatggtgggggtggtcctggaatgggt
cctattggtgttaagaagcacttagcaccatttttaccatctcatccagtgatcaccacc
ggtggcttccctctccctgagaaaaccgaccctcttggtaccatttctgctgccccatgg
ggatcagcgttgattctaccaatttcctacacatacatagccatgatgggttctaagggt
ctcactgatgcttcaaagattgcaatcttgaatgcaaactacatgacaaagcgtctggag
aaacactacccagttcttttccgtggagtcaatggaactgttgcccatgagttcattatt
gatttaagaggatttaagacgactgctggtatagagccagaggatgttgcaaagcgtttg
atggactatggattccatgcacctactatgtcatggcctgttccaggcacacttatgatt
gaaccaactgaaagtgaaagcaaggccgaactagataggttctgtgatgctctaatctca
atcagggaagaaattgcagagatagaaagtggcaaagcagatgtgaacaacaacgtcctc
aagagtgctcctcacccgccccaacttctgatgagcgactcatggactaagccgtactcc
agggagtatgctgcgttccctgcagcgtggcttcggggcgccaagttctggccaacaaca
tgtcgcgtggacaatgtgtacggggatcgcaacctcatctgcactctgcaacagggatcc
caagtcgcagaagaagctgcagctgctaccgcatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341790
Entry
4341790           CDS       T01015                                 
Name
(RefSeq) glycine cleavage system H protein 2, mitochondrial
  KO
K02437  glycine cleavage system H protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4341790
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4341790
SSDB
Motif
Pfam: GCV_H Biotin_lipoyl RnfC_N
Other DBs
NCBI-GeneID: 4341790
NCBI-ProteinID: XP_015643398
UniProt: B9FQE3 Q655T6
LinkDB
Position
6:complement(27659148..27661195)
AA seq 160 aa
MAAAAAASRALWACRTASYLRISSFPRAFSTVLKDLKYADTHEWVKVEGDSATIGVTDHA
QDHLGDVVYVELPEVGSTVSQGTNFGAVESVKATSDINAPVSGEIIQVNDELSEKPGFIN
GSPYEKGWIIKVKISDPSELNSLMDDEKYKKFCEEEDGKH
NT seq 483 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgccgcctcaagggcgctctgggcttgccgcaccgcctcctacctt
cggatctcctccttccccagggctttctccaccgtccttaaagatctaaaatatgctgat
actcatgagtgggtgaaggttgagggtgattcagcaaccataggggtcacagaccatgct
caggaccatttgggtgatgttgtgtatgttgagcttccagaagttggttccacagtatca
caaggaacgaactttggtgcggttgaaagtgtgaaagcaaccagtgatatcaatgcacca
gtatctggagagattattcaagtaaatgatgaactaagtgaaaaaccaggatttataaat
ggaagtccatatgagaagggatggatcatcaaggttaagataagtgatccaagtgagtta
aactcgctgatggatgatgagaagtacaagaagttttgtgaggaagaagatggcaaacac
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349114
Entry
4349114           CDS       T01015                                 
Name
(RefSeq) glycine cleavage system H protein, mitochondrial
  KO
K02437  glycine cleavage system H protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4349114
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4349114
SSDB
Motif
Pfam: GCV_H Biotin_lipoyl ADSL_C RnfC_N
Other DBs
NCBI-GeneID: 4349114
NCBI-ProteinID: XP_015613006
UniProt: A3C6G9
LinkDB
Position
10:19894713..19896804
AA seq 164 aa
MALRLWASSAANALKISCSGATRAAPAYSISRYFSTVLDGLKYSSSHEWVKNDGSVATIG
ITDHAQGHLGEVVFVELPEAGAKVSQGGAFGNVESVKATSDINSPISGEVVEVNDKLSET
PGLINSSPYEDGWMIKVKPSSPSELDALLDPAKYTKHCEEEDAH
NT seq 495 nt   +upstreamnt  +downstreamnt
atggctctgaggctgtgggctagctcagctgccaatgccctcaagatctcatgcagtgga
gccaccagggctgcacctgcctactcaatctccagatacttctccactgttcttgatggg
ttgaagtacagctcctctcatgagtgggtcaagaatgatggctctgtggccacaattgga
attacagaccatgctcagggccatctgggagaggtggtgttcgtggagctgccggaggcg
ggggcgaaggtgagccagggaggtgcattcggcaacgtggagagtgtgaaggccaccagc
gacatcaactcccccatctccggtgaggtcgtcgaggttaacgacaagctctctgagaca
cccggcctgattaactcaagcccgtacgaggacgggtggatgatcaaggtgaagccgagc
agcccgtcggagctggacgccctgctggacccggccaagtacaccaagcactgcgaggag
gaagacgctcactag

DBGET integrated database retrieval system