KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325937
Entry
4325937           CDS       T01015                                 
Name
(RefSeq) cytidine deaminase 1
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4325937
Enzymes [BR:osa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     4325937
SSDB
Motif
Pfam: dCMP_cyt_deam_2 dCMP_cyt_deam_1 OTT_1508_deam DUF2065
Other DBs
NCBI-GeneID: 4325937
NCBI-ProteinID: XP_015621794
UniProt: Q8S0I1 A0A0P0V7D2
LinkDB
Position
1:complement(29605129..29606558)
AA seq 312 aa
MGEEKVAPKSDAAPAVELLGFVMSAEEAERAAAAAGVETVEDLLPLLVPSAMRRARAPIS
RFPVGAVGLGASGRVYAGVNLEFRGLPLSHSVHAEQFLVVNAAAAGESELRAVAVSHMPC
GHCRQFLQEIRGAGGIRIIVTSDAEDGCAPEWRTVASLLPRPFGPHDLLPKHVPLVLEPH
DNPLGEPAAVANGFAHGDLEARLREAAEAAARAAHAPYSECPSGFAVADGEGKVYAGGCL
ESAAYNPTLGPVQAAIIGMVAAGGGAAGDVVAAALVEKEAGLVSQEATARIFLAAVAPQA
TFHVYNYTPSDA
NT seq 939 nt   +upstreamnt  +downstreamnt
atgggggaggagaaagtggcgccgaagtctgacgctgccccggcggtggagttgctgggg
ttcgtgatgagcgcggaggaggccgagcgcgccgcggcggcggccggggtggagacggtg
gaggacctgctgccgctgctcgtcccttccgcgatgcggcgcgcgcgtgccccgatctcg
cggttccccgtgggcgccgtgggcctcggcgcgagcggccgcgtctacgccggcgtcaac
ctcgagttccggggcctcccgctgtcccattccgtccacgccgagcagttccttgtcgtc
aacgcggccgccgcgggggagtcggagctgcgcgccgtcgccgtctcccacatgccctgc
ggccactgccgccagttcctccaggagatccgcggcgccggtgggatccgaatcattgtc
acctccgacgccgaggacggctgcgcccccgagtggcgcacggtggcgtccctcctcccg
cgccccttcgggccccatgatctcctccccaagcacgtccccctcgtcctcgaaccgcac
gacaaccctctcggcgaacccgccgccgtcgccaatggcttcgcccacggtgacctagag
gcgcgcctgagggaggcagcggaggcggccgcgcgggcggcgcatgcgccgtatagcgag
tgcccgtcgggattcgccgtggcggacggcgaagggaaggtgtacgccggaggatgcctg
gagtccgcggcgtataatccgacactaggccccgtgcaggcggccatcatagggatggtg
gccgccgggggcggcgccgccggagacgtggtggcggcggcgctcgtggagaaggaagcg
gggttggtgtcgcaggaagcgacggccaggatcttcctggccgcggtggccccacaggcc
accttccacgtgtacaattatacaccgtccgatgcatga

DBGET integrated database retrieval system