KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325946
Entry
4325946           CDS       T01015                                 
Name
(RefSeq) ras-related protein Rab7
  KO
K07897  Ras-related protein Rab-7A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4325946
   04145 Phagosome
    4325946
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4325946
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4325946
   04031 GTP-binding proteins [BR:osa04031]
    4325946
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    4325946
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4325946
  Exosomal proteins of other body fluids (saliva and urine)
   4325946
  Exosomal proteins of colorectal cancer cells
   4325946
  Exosomal proteins of bladder cancer cells
   4325946
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    4325946
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU AAA_16 RsgA_GTPase AAA_22 Septin AAA_5 AAA_7 NTPase_1 AAA_24 PduV-EutP cobW DAP3 G-alpha SRPRB NACHT Sigma54_activat NB-ARC MCM ATPase_2 TniB
Other DBs
NCBI-GeneID: 4325946
NCBI-ProteinID: XP_015632387
UniProt: Q5JLU1 A0A0P0V7B6
LinkDB
Position
1:complement(29730135..29735136)
AA seq 207 aa
MSTSRRRTLLKVIVLGDSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKEVLIEDRLVTL
QIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSNRSFDTLNTWHDEFLNQASPSDPKTFP
FILLGNKIDVDGGKSRVVSEKKAMEWCSSKGNIPYFETSAKEDRNVDSAFLSVAKLALEH
ERDQDIYFQTVVPDPVPEAEQRSGCAC
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtcgacgtcgcgcaggaggaccctcctcaaggtcatcgtcctcggcgacagcggggtg
gggaagacgtcgcttatgaaccaatatgttcacaagaagtttagccagcagtacaaagct
acaattggtgcggatttcgtcaccaaggaggtcctcattgaagataggctcgtgactctg
cagatctgggacactgcggggcaggagaggttccagagtcttggtgttgcgttttacaga
ggagcagattgttgtgtgctcgtctatgacgtcaattctaacaggtcatttgacacgctc
aacacatggcatgatgagttcctcaaccaagctagcccatcagatcccaaaacttttcca
ttcatcttacttgggaacaagattgacgtagatggagggaaaagcagagtggtttctgag
aaaaaagcaatggagtggtgttcatccaaaggcaatattccttattttgaaacttctgca
aaagaggaccgcaatgtcgacagtgcgttcttgtctgtcgctaagcttgctttagagcat
gagcgtgatcaggacatctacttccagacggttgttccagatcctgttccagaggctgaa
cagagaagtggatgtgcatgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327180
Entry
4327180           CDS       T01015                                 
Name
(RefSeq) ras-related protein Rab7
  KO
K07897  Ras-related protein Rab-7A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4327180
   04145 Phagosome
    4327180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4327180
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4327180
   04031 GTP-binding proteins [BR:osa04031]
    4327180
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    4327180
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4327180
  Exosomal proteins of other body fluids (saliva and urine)
   4327180
  Exosomal proteins of colorectal cancer cells
   4327180
  Exosomal proteins of bladder cancer cells
   4327180
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    4327180
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 Septin NTPase_1 SRPRB AAA_7 AAA_16 AAA_22 PduV-EutP AAA_24 ATPase_2 TniB NACHT RNA_helicase MCM NB-ARC AAA_5
Other DBs
NCBI-GeneID: 4327180
NCBI-ProteinID: XP_015649338
UniProt: B9EUG4 Q5N7Z9
LinkDB
Position
1:7043941..7047553
AA seq 207 aa
MASRRRMLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQIDDRLFTLQ
IWDTAGQERFQSLGVAFYRGADCCVLVYDVNVTKSFERLNSWREEFLIQASPSDPENFPF
VVLGNKIDVDGGNSRTVSEKKAKAWCASKGNIPYFETSAKEGFNVEAAFECIARNAIKNE
PEEEIYLPDTIDVGGAGRQQRSSGCEC
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgtcgcgcaggcgaatgctcctcaaggtcatcatcctcggtgacagcggggtcggg
aagacgtctctgatgaaccagtacgtgaacaagaagttcagcaatcagtacaaagcgacg
atcggcgcggatttcctgaccaaggaggtgcagatcgacgaccggctcttcacattgcag
atttgggacacagcgggacaggagcgatttcagagtcttggtgtggcattttaccgggga
gctgactgctgtgttcttgtatatgatgtcaatgttaccaagtcatttgaaaggctcaac
agctggcgtgaggaattcctaattcaagctagcccatcagatccagagaatttccctttt
gttgtacttggaaacaaaattgatgttgatggtggtaatagccggactgtttctgagaag
aaagctaaagcttggtgtgcttctaagggaaacatcccttattttgagacatctgctaaa
gaaggcttcaacgtggaggctgcttttgagtgtatagcaaggaatgctatcaagaatgaa
ccggaagaggagatatatcttcctgatacaattgatgttggaggtgctggaaggcaacag
cgctcgtcaggctgtgaatgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339322
Entry
4339322           CDS       T01015                                 
Name
(RefSeq) ras-related protein Rab7
  KO
K07897  Ras-related protein Rab-7A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4339322
   04145 Phagosome
    4339322
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339322
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339322
   04031 GTP-binding proteins [BR:osa04031]
    4339322
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    4339322
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4339322
  Exosomal proteins of other body fluids (saliva and urine)
   4339322
  Exosomal proteins of colorectal cancer cells
   4339322
  Exosomal proteins of bladder cancer cells
   4339322
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    4339322
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_16 ATP_bind_1 AAA_22 SRPRB PduV-EutP NTPase_1 Septin AAA_7 AAA_24 ATPase_2 cobW RNA_helicase MCM NACHT NB-ARC DAP3 TniB AAA_5 G-alpha
Other DBs
NCBI-GeneID: 4339322
NCBI-ProteinID: XP_015639739
UniProt: Q75IJ1 Q0DGR3
LinkDB
Position
5:25620526..25623307
AA seq 206 aa
MASRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQ
IWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPF
VLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKDGTNVEEAFQCIVKNALKNE
PEEELYVPDTVDVVGGNRAQRSSGCC
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcttcgcgccgccgcaccctcctcaaggtcatcatcctcggcgacagcggggttggg
aagacgtccctgatgaaccaatatgtgaacaagaagttcagcaaccagtacaaggctacg
attggcgcggatttcctcaccaaggaggttcagttcgaggataggctcttcactttgcaa
atatgggatactgctggccaggaaaggtttcagagtcttggtgttgcattctaccgtgga
gcagattgctgtgttctagtttatgatgtcaattctatgaagtcatttgataatcttaac
aactggcgtgaagaatttctaattcaggcaagcccatcagaccctgataacttccctttt
gttcttttgggcaacaaagttgatgtagacggtggcaacagccgtgtggtctctgagaag
aaggcaaaggcatggtgtgcctctaaagggaatatcccatactttgagacatctgccaag
gatggtacaaacgtggaggaggctttccagtgcattgtaaagaatgctctgaagaatgaa
ccagaggaagaactgtatgtgccggacaccgtggatgtggtgggtggcaaccgggcccaa
agatcatcaggctgctgctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339450
Entry
4339450           CDS       T01015                                 
Name
(RefSeq) ras-related protein Rab7
  KO
K07897  Ras-related protein Rab-7A
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4339450
   04145 Phagosome
    4339450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4339450
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339450
   04031 GTP-binding proteins [BR:osa04031]
    4339450
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    4339450
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   4339450
  Exosomal proteins of other body fluids (saliva and urine)
   4339450
  Exosomal proteins of colorectal cancer cells
   4339450
  Exosomal proteins of bladder cancer cells
   4339450
GTP-binding proteins [BR:osa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    4339450
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_16 AAA_22 Septin AAA_7 cobW NTPase_1 PduV-EutP AAA_24 AAA_5 SRPRB ATPase_2 NB-ARC NACHT MCM G-alpha TniB DAP3
Other DBs
NCBI-GeneID: 4339450
NCBI-ProteinID: XP_015638303
UniProt: B9FLC1 Q0DGE4
LinkDB
Position
5:26664487..26666541
AA seq 206 aa
MASSRRRTLLKVIVLGDSGVGKTSLMNQYVNKKFSQQYKATIGADFVTKEVLIEDRLVTL
QIWDTAGQERFQSLGVAFYRGADCCMLVYDVNAKRSFNALNTWHDEFLTQASPSDPKHFP
FILLGNKIDIDAGNRRAIPEKKAKEWCVSKGNIPYFETSAKDDYNVDSAFLCIAKLALEH
EHDQDIYFKTVAQPAPDTEHTSGCAC
NT seq 621 nt   +upstreamnt  +downstreamnt
atggcgtcgtcgcggaggcggacgctgctcaaggtcatcgtcctcggcgacagcggggtg
gggaagacgtccctgatgaaccaatacgtgaacaagaagtttagccagcagtacaaggcg
acgatcggcgccgatttcgtcaccaaggaggttctcattgaagacaggcttgtcaccttg
cagatctgggacacggcaggacaggagaggtttcagagtctcggtgtggcgttctacaga
ggtgcagattgctgtatgctagtctacgatgtcaatgctaaaagatctttcaatgcactc
aacacctggcatgatgagttcctcacccaagctagcccatcagatcccaaacattttccc
ttcatattactcggcaacaagattgacatagatgccggaaacagacgtgccatccctgag
aagaaagcaaaagagtggtgcgtctccaaaggcaacattccgtatttcgaaacctctgcg
aaagacgactacaatgttgacagtgcttttctgtgcattgccaagcttgctctggagcat
gagcatgatcaggacatctacttcaagactgttgcacaaccagcccctgatactgaacat
accagcggatgtgcttgctag

DBGET integrated database retrieval system