KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325991
Entry
4325991           CDS       T01015                                 
Name
(RefSeq) mannose-6-phosphate isomerase 1 isoform X1
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4325991
   00520 Amino sugar and nucleotide sugar metabolism
    4325991
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     4325991
SSDB
Motif
Pfam: PMI_typeI_cat PMI_typeI_hel PMI_typeI_C Cupin_2
Other DBs
NCBI-GeneID: 4325991
NCBI-ProteinID: XP_015624158
UniProt: Q9FTR6 A0A0P0UXT7
LinkDB
Position
1:1534077..1539624
AA seq 428 aa
MAGPTPPPPEEEPSSPSLRLRCAVQHYEWGRRGEASLVARLSDANADDHGPDPARPYAEL
WMGTHPSAPSSLLADGLLRDWLARHPAALGPAVAARWGGDLPFLFKVLSVAKALSIQAHP
DKDLAEVLHALRPATYKDGNHKPEMAIAVTEFRVLCGFAGIQELKDVLRTVPEVEDLVGP
EDAAKLLSVKEYHGVNEVKSCLRSAFTKLMTASKEAVSEAITKLIFRLNAESKVRTLTEK
ENLVLSLEKQYPEDVGVLSAFFFNYIKLSPGEALYIGANEPHAYLSGECIECMATSDNVV
RAGLTPKYRDVQTLCSMLTYKQVFPEILRGVPVQPYVRRYTPPFDEFEVDCCSLPPGELV
VISPVSGPSVYLVMAGEGEIQVDSMPNGEKSKQGDVFFVPAYTEVKFSASGPECMQLYRA
GVNSRFFN
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggccggccctactcctcctccgccggaggaggagccctcctccccttccctgcgcctg
cgctgcgcggtgcagcactacgagtggggccgacgcggggaggcctccctcgtcgcccgc
ctctccgacgccaacgccgacgaccacggccccgaccccgcgcgcccctacgccgagctg
tggatgggcacgcacccctccgcgccctcctccctcctcgccgacggcctcctcagggac
tggctcgcgcgccaccccgccgcgctcggccccgccgtcgccgctcgctggggaggcgac
ctcccattcctcttcaaggttctgtcggtggccaaggcgctgtcgatccaggcgcacccg
gacaaggacctcgccgaggtgctgcacgcgctgcgtccggccacctacaaggacggcaac
cacaagcccgagatggccatcgccgtcaccgagttccgcgtcctctgcggctttgccggt
atccaggaacttaaggacgttttaagaactgtgcctgaagttgaagaccttgttggacct
gaagatgctgccaagcttttgtctgtgaaagagtaccatggtgtcaatgaagtaaaatcc
tgtctgcggtcagcttttactaagctaatgacagctagtaaagaagcggtttctgaagca
attacaaaattgatttttcgcctgaatgctgagagcaaggtaaggaccttaaccgagaaa
gaaaatctagttttgtcgctggagaaacaatacccagaagatgttggtgttctatcagca
tttttcttcaattatatcaagctcagtcctggtgaagcactttacattggtgccaatgaa
ccacatgcatatctatccggggaatgcattgaatgtatggccacttcagataatgttgtt
cgtgctggtttgacacccaagtacagagatgtgcaaactctttgctctatgctaacatac
aaacaggtctttccagaaatcttgcggggggttcctgtacagccgtatgtaagaaggtac
acccctccgtttgatgagttcgaagttgactgctgctcactaccaccaggcgaactggtt
gtgatatccccagtgtcaggtccatccgtctacctagtgatggccggggaaggcgagatc
caggtagattccatgccaaatggtgaaaagtctaaacaaggtgatgttttcttcgtgcca
gcatacaccgaggttaagttctctgcctctggtcctgagtgcatgcagctgtacagggct
ggggtcaatagcagattcttcaattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350861
Entry
4350861           CDS       T01015                                 
Name
(RefSeq) mannose-6-phosphate isomerase 1
  KO
K01809  mannose-6-phosphate isomerase [EC:5.3.1.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00051  Fructose and mannose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00114  Ascorbate biosynthesis, plants, fructose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    4350861
   00520 Amino sugar and nucleotide sugar metabolism
    4350861
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     4350861
SSDB
Motif
Pfam: PMI_typeI_cat PMI_typeI_hel Cupin_2 PMI_typeI_C
Other DBs
NCBI-GeneID: 4350861
NCBI-ProteinID: XP_015615379
UniProt: Q2R1L4
LinkDB
Position
11:23077522..23081684
AA seq 460 aa
MASSTTASSQLALALGIPGLGGLLIPTDAAATTTTTAEGNDLHADASHPVLRLAGAVQHY
EWGGRRGSSLVARLAGEGDDGDERPYAELWMGTHPAAPSSLAASGESLREWLGRRGPAAL
LGRDVAARWGGDLPFLFKVLSVARALSIQAHPDAALARALHALRPATYRDDNHKPEMAVA
VTDFRALCGFVSVQELKDVLRTVPEVRELVGKEEAVKLMGAKEHDGGIGVRSYLQSAFTN
LMTASKETVSEAVSKLKSRLNIESKVRTLTKKEQLVLSLEMQYPEDVGVLAAFFFNYVKL
NPGEALYIGANEPHAYLSGECVECMATSDNVVRAGLTPKYRDVQTLCSMLTYKQNYPEIL
RGVPVQAYVTRYIPPSEEFEVDRCLLPSGESVTMSPVPGPSIFLVMTGEGKIEADSMLDE
GKAKEGDVFFVPAHTEVRILASGPGSMQLYRAGVNSRFFS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggcctcctccaccaccgcctcctcccagctcgccctcgccctcggcatccccggcctc
ggcggcctcctcatccccaccgacgccgccgccaccaccaccaccaccgccgagggcaac
gatctccacgccgacgcctcccaccccgtcctccgcctcgccggcgccgtccagcactac
gagtggggcggccgtcgcgggtcctccctcgtcgcgcgcctcgccggcgagggcgatgat
ggtgatgagaggccgtacgcggagctgtggatggggacgcacccggcggcgccgtcgtcg
ctggcggcgtcgggggagtcgctgagggagtggctggggaggcgcggccccgccgcgctc
ctcggccgcgacgtggcggcgaggtggggcggcgacctcccgttcctcttcaaggtgctc
tcggtcgccagggcgctctccatccaggcccaccccgacgccgccctcgccagggcgctc
cacgcgctccgccccgccacgtaccgcgacgacaaccacaagcccgagatggccgtcgcc
gtcaccgacttccgcgccctctgcggcttcgtctccgtccaggagctcaaggatgtcttg
aggactgtacctgaggttcgagagttagttggcaaagaagaggctgtgaagcttatgggt
gccaaagagcatgatggaggcatcggagtaaggtcatatctgcaatcagcttttactaat
ttaatgacagcaagcaaagaaacagtttctgaagcagtctcaaagctaaagagtcggctg
aatattgagagtaaggttagaaccttgacaaagaaggagcagctagtgttgtcactggag
atgcagtaccctgaagatgttggtgttttagcagcattcttctttaactatgtcaagctc
aaccccggtgaagcactctatattggtgctaatgaaccacatgcatatctttcgggagag
tgcgtcgaatgtatggccacatctgacaatgtagttcgtgctggtctgacccctaaatac
agagacgtccaaactctttgctcgatgctgacatacaagcagaactacccggagattctg
cgaggagttccagtgcaagcatatgtaacgcgctacatacccccatctgaggagtttgaa
gtcgatcgctgcctgctgccctccggtgaatcggtcaccatgtcaccggtgcctggccca
tccatcttccttgtcatgacaggggaaggcaagattgaggcagattccatgcttgatgaa
ggaaaggcaaaggaaggcgatgttttcttcgtgccggcgcacaccgaggtcaggatcctt
gcttctggtcctgggagcatgcagctttacagggctggggtgaacagcagattcttcagc
tga

DBGET integrated database retrieval system