KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326014
Entry
4326014           CDS       T01015                                 
Name
(RefSeq) ferredoxin--nitrite reductase, chloroplastic
  KO
K00366  ferredoxin-nitrite reductase [EC:1.7.7.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Module
osa_M00531  Assimilatory nitrate reduction, nitrate => ammonia
osa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4326014
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.7  With an iron-sulfur protein as acceptor
    1.7.7.1  ferredoxin---nitrite reductase
     4326014
SSDB
Motif
Pfam: NIR_SIR NIR_SIR_ferr
Other DBs
NCBI-GeneID: 4326014
NCBI-ProteinID: XP_015641702
UniProt: Q42997 B9EWP3
LinkDB
Position
1:14446913..14453463
AA seq 596 aa
MASSASLQRFLPPYPHAAASRCRPPGVRARPVQSSTVSAPSSSTPAADEAVSAERLEPRV
EQREGRYWVLKEKYRTGLNPQEKVKLGKEPMSLFMEGGIKELAKMPMEEIEADKLSKEDI
DVRLKWLGLFHRRKHQYGRFMMRLKLPNGVTTSEQTRYLASVIEAYGKEGCADVTTRQNW
QIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRNPVGNPLAGIDPDEIVDTRSYTNLLSS
YITSNFQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKGGKFGFNLLVGGFIS
PKRWEEALPLDAWVPGDDIIPVCKAVLEAYRDLGTRGNRQKTRMMWLIDELGMEAFRSEV
EKRMPNGVLERAAPEDLIDKKWQRRDYLGVHPQKQEGMSYVGLHVPVGRVQAADMFELAR
LADEYGSGELRLTVEQNIVIPNVKNEKVEALLSEPLLQKFSPQPSLLLKGLVACTGNQFC
GQAIIETKQRALLVTSQVEKLVSVPRAVRMHWTGCPNSCGQVQVADIGFMGCLTKDSAGK
IVEAADIFVGGRVGSDSHLAGAYKKSVPCDELAPIVADILVERFGAVRREREEDEE
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggcctcctccgcctccctgcagcgcttcctccccccgtacccccacgcggcagcatcc
cgctgccgccctcccggcgtccgcgcccgccccgtgcagtcgtcgacggtgtccgcaccg
tcctcctcgactccggcggcggacgaggccgtgtcggcggagcggctggagccgcgggtg
gagcagcgggagggccggtactgggtgctcaaggagaagtaccggacggggctgaacccg
caggagaaggtgaagctggggaaggagcccatgtcattgttcatggagggcggcatcaag
gagctcgccaagatgcccatggaggagatcgaggccgacaagctctccaaggaggacatc
gacgtgcggctcaagtggctcggcctcttccaccgccgcaagcatcagtatgggcggttc
atgatgcggctgaagctgccaaacggtgtgacgacgagcgagcagacgaggtacctggcg
agcgtgatcgaggcgtacggcaaggagggctgcgccgacgtgacaacccgccagaactgg
cagatccgcggcgtcacgctccccgacgtgccggccatcctcgacgggctcaacgccgtc
ggcctcaccagcctccagagcggcatggacaacgtccgcaaccccgtcggcaacccgctc
gccggcatcgaccccgacgagatcgtcgacacgcgatcctacaccaacctcctctcctcc
tacatcaccagcaacttccagggcaaccccaccatcaccaacctgccgaggaagtggaac
gtgtgcgtgatcgggtcgcacgatctgtacgagcacccacacatcaacgacctcgcgtac
atgccggcggtgaagggcggcaagttcgggttcaacctcctcgtcggcgggttcataagc
cccaagaggtgggaggaggcgctgccgctcgacgcctgggtccccggcgacgacatcatc
ccggtgtgcaaggccgttctcgaggcgtaccgcgacctcggcaccaggggcaaccgccag
aagacccgcatgatgtggctcatcgacgaacttggaatggaggcttttcggtcggaggtg
gagaagaggatgccgaacggcgtgctggagcgcgcggcgccggaggacctcatcgacaag
aaatggcagaggagggactacctcggcgtgcacccgcagaagcaggaagggatgtcctac
gtcggcctgcacgtgcccgtcggccgggtgcaggcggcggacatgttcgagctcgcacgc
ctcgccgacgagtacggctccggcgagctccgcctcaccgtggagcagaacatcgtgatc
ccgaacgtcaagaacgagaaggtggaggcgctgctctccgagccgctgcttcagaagttc
tccccgcagccgtcgctgctgctcaagggcctcgtcgcgtgcaccggcaaccagttctgc
ggccaggccatcatcgagacgaagcagcgggcgctgctggtgacgtcgcaggtggagaag
ctcgtgtcggtgccccgggcggtgcggatgcactggaccggctgccccaacagctgcggc
caggtgcaggtcgccgacatcggcttcatgggctgcctcaccaaggacagcgccggcaag
atcgttgaggcggccgacatcttcgtcggcggccgcgtcggcagcgactcgcacctcgcc
ggcgcgtacaagaagtccgtgccgtgcgacgagctggcgccgatcgtcgccgacatcctg
gtcgagcggttcggggccgtgcggagggagagggaggaggacgaggagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330835
Entry
4330835           CDS       T01015                                 
Name
(RefSeq) ferredoxin--nitrite reductase, chloroplastic-like
  KO
K00366  ferredoxin-nitrite reductase [EC:1.7.7.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Module
osa_M00531  Assimilatory nitrate reduction, nitrate => ammonia
osa_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4330835
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.7  With an iron-sulfur protein as acceptor
    1.7.7.1  ferredoxin---nitrite reductase
     4330835
SSDB
Motif
Pfam: NIR_SIR NIR_SIR_ferr
Other DBs
NCBI-GeneID: 4330835
NCBI-ProteinID: XP_015623764
UniProt: B9F3E6
LinkDB
Position
2:complement(32254054..32257145)
AA seq 501 aa
MEGGIKELAKMPMEEIEADKLSKEDIDVRLKWLGLFHCHKHQYGRFMMRLKLPNGVTTSE
QTRYLASVIEAYGKDGCADVTTRQNWQIRGVTLPDVPAILDGLNAVGLTSLQSGMDNVRN
PVGNPLAGIDPDEIVDTRSYTNLLSYITSNFQGNPTITNLPRKWNVCVIGSHDLYEHPHI
NDLAYMPAVKDGKFGFNLLVGGFISPKRWEEALPLDAWVPGDDIIPVCKAVLEAYCDLGT
RGNRQKTRMMWLIDELGMEVFWSEVEKRMPNGVLERAAPEDLIDKKWQRRDYLGVHPQKQ
EGLSYVGLHVPVGRVQAADMFELARLADEYGSGELRLTVEQNIVIPNVKDEKVEALLAEP
LLQKFSPQPSLLLKGLVACTGNQFCGQAIIETKQRALLVTSQVEKLVSVPRAVRMHWTGC
PNSCGQVQVADIGFMGCLTKDSAGKIVEAADIFVGGRVGSDSHLAGVYKKSVPCDELAPI
VADILVERFGAVRREREENEE
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggagggcggcatcaaggagctcgccaagatgcccatggaggagatcgaggccgacaag
ctctccaaggaggacatcgacgtgcgtctcaagtggctcggcctcttccactgccacaag
catcagtatgggcggttcatgatgcggctgaagctgccaaacggcgtgacgacgagcgag
cagacgaggtacctggcgagcgtgatcgaggcgtacggcaaggatggctgcgccgacgtg
acaacccgccagaactggcagattcgcggcgtcacgctccccgacgtgccggccatcctc
gacgggctcaacgccgtcggcctcaccagccttcagagcggcatggacaacgtccgcaac
cccgtcggcaacccgctcgccggcatcgaccccgacgagatcgtcgacacccgatcctac
accaacctcctctcctacatcaccagcaacttccagggcaaccccaccatcaccaacctg
ccgaggaagtggaacgtgtgcgtgatcgggtcgcacgatctgtacgagcacccgcacatc
aacgatctcgcgtacatgccggcggtgaaggacggcaagttcgggttcaacctcctcgtc
ggcgggttcatcagccccaagaggtgggaggaggcgctgccgctcgacgcctgggtcccc
ggcgacgacatcatcccggtgtgcaaggccgttctcgaggcgtactgcgacctcggcacc
aggggcaaccgccagaagacccgcatgatgtggctcatcgacgaacttgggatggaggtt
ttctggtcggaggtggagaagaggatgccgaacggcgtgctggagcgcgcggcgccggag
gacctcatcgacaagaaatggcagaggagggactacctcggcgtgcacccgcagaagcag
gaagggctgtcctacgtcggcctgcacgtgcccgtgggacgggtgcaggcggcggacatg
ttcgagctcgcgcgcctcgccgacgagtacggctccggcgagctccgcctcaccgtggag
cagaacatcgtgatcccgaacgtcaaggatgagaaggtggaggcgctgctcgccgagccg
ctgcttcagaagttctccccgcagccgtcgctgctgctcaagggcctcgtcgcgtgcacc
ggcaaccagttctgcggccaggccatcatcgagacgaagcagcgggcgctgctggtgacg
tcgcaggtggagaagctcgtgtcggtgccccgggcggtgcggatgcactggaccggctgt
ccaaacagctgcggccaggtgcaggtcgccgacatcggattcatgggctgcctcaccaag
gacagcgccggcaagatcgtcgaggcggccgacatcttcgtcggcggccgcgtcggcagc
gactctcacctcgccggcgtgtacaagaagtccgtgccgtgcgacgagctggcgccgatc
gtcgccgacatcctggtcgagcggttcggggccgtgcggagggagagggaggagaacgag
gagtag

DBGET integrated database retrieval system