KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326022
Entry
4326022           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S4-like
  KO
K02987  small subunit ribosomal protein S4e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326022
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326022
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4326022
  Archaea
    4326022
SSDB
Motif
Pfam: Ribosomal_S4e 40S_S4_C RS4NT S4 KOW
Other DBs
NCBI-GeneID: 4326022
NCBI-ProteinID: XP_015622456
UniProt: Q0JMU9 Q5ZBX1
LinkDB
Position
1:14513273..14515342
AA seq 265 aa
MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE
VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK
FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNV
VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHAFATRLGNVFTIGKGNKPWVSLPK
GKGIKLSIIEEQRKRDAAAQAAANA
NT seq 798 nt   +upstreamnt  +downstreamnt
atggcgaggggattgaagaagcatctcaagaggctcaatgcgcccaagcactggatgctc
gacaagctcggcggagcttttgcccccaagccatcgtctggacctcacaagtccagggaa
tgcctgcccctgatcctcatcatcaggaacaggttgaagtatgcgctgacataccgtgag
gttatctctatcctgatgcagcggcatgtcttggttgatgggaaggtcaggactgacaag
acctaccctgctggtttcatggatgtgatttccattccaaagactggtgagaactacagg
cttctctatgacaccaagggtcgcttccgccttcagtccgtcaaggatgaggatgccaag
ttcaagctttgcaaagttcggtctgtccagtttggacagaagggcattccctatctgaac
acctatgatggacgcaccatccgctacccggaccctttgattaaggctaacgacacaatc
aagattgatcttgagaccaacaagattgttgacttcatcaagtttgatgtgggcaatgtc
gttatggtcacaggagggaggaacactggtcgtgttggagtaattaagaacagggagaag
cacaagggcagttttgagaccatccatgtggaggacgcattgggccatgccttcgccacc
cgtctgggcaatgtgttcaccatcggcaagggcaacaagccatgggtgtctctccctaag
ggcaagggtatcaagctcagcatcatcgaggaacagaggaagcgagatgctgctgctcag
gctgctgcaaatgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328016
Entry
4328016           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S4
  KO
K02987  small subunit ribosomal protein S4e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328016
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4328016
  Archaea
    4328016
SSDB
Motif
Pfam: Ribosomal_S4e 40S_S4_C RS4NT S4 KOW
Other DBs
NCBI-GeneID: 4328016
NCBI-ProteinID: XP_015625833
UniProt: P49398 A3A284 Q0E4Q0
LinkDB
Position
2:complement(316699..319148)
AA seq 265 aa
MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE
VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK
FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKIDLETNKIVDFIKFDVGNV
VMVTGGRNTGRVGVIKNREKHKGSFETIHVEDALGHQFATRLGNVFTIGKGNKPWVSLPK
GKGIKLSIIEEQRKRDAAAQAAANA
NT seq 798 nt   +upstreamnt  +downstreamnt
atggcaaggggtttgaagaagcatctgaagaggctcaatgcgcccaagcattggatgctc
gacaagcttggtggagcttttgcccccaagccatcttctggtcctcacaagtccagggag
tgcctgcctctgatcctcattatcaggaacaggctcaagtatgctctgacataccgtgag
gttatttctatcctcatgcagcgccatgtcttggttgatggcaaggtcaggactgacaag
acctacccagctggtttcatggatgtcatttccatccccaagactggtgagaactacagg
cttctgtacgacaccaagggacgtttccgccttcagtctgtcaaggatgaggatgctaag
ttcaagctttgcaaggttcggtctgtgcagtttggccagaagggaatcccctacctgaac
acctatgatggtcgcaccatccgctaccctgacccgatcatcaaggcaaacgacacaatc
aagatcgatctggagaccaacaagattgtcgacttcatcaagtttgatgttggcaatgtt
gtcatggtgactggaggaaggaacacaggccgtgttggtgtgatcaagaacagggagaag
cataaaggcagcttcgagaccatccacgttgaggatgccctgggccaccaattcgccacc
cgtctgggcaatgtgttcaccattggcaagggcaacaagccttgggtgagcctgcccaag
ggcaagggcatcaagctcagcatcatcgaggagcaaaggaagcgggatgctgccgcccag
gctgctgccaacgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338571
Entry
4338571           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S4-like
  KO
K02987  small subunit ribosomal protein S4e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4338571
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4338571
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4338571
  Archaea
    4338571
SSDB
Motif
Pfam: Ribosomal_S4e 40S_S4_C RS4NT KOW S4 Sipho_tail dCache_2
Other DBs
NCBI-GeneID: 4338571
NCBI-ProteinID: XP_015637379
UniProt: Q0DIR7 A0A0P0WLF0
LinkDB
Position
5:17693053..17695778
AA seq 263 aa
MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE
VISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAK
FKLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKIDLETNKIVDFIKFDVGNI
VMVTGGRNTGRVGVIKSREKHKGSFETIHVEDALGHQFATRMGNVFTIGKERKPWVSLPK
GKGIKLSIIEEARKRNAEAAAEA
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcgaggggtttgaagaagcatctgaagaggctcaatgcccccagccattggatgctt
gacaagcttggtggagcatttgcacccaagccttcttctggtccccacaaagctcgggag
tgcttgcctttgatccttatcctcaggaacaggttgaagtatgctctgacctaccgtgag
gttatttccatcttgatgcagcggcatgttatggttgatggaaaggtcaggactgacaag
acttatccggctggattcatggacgttgtgtcaattgcaaagactggggagaatttccgc
cttctgtatgacaccaagggtcgcttccgtctccacagcatcaaggatgaggacgctaag
ttcaagctctgcaaggtccggtctgtacagtttggacagaagggtattcctttcctgaac
accaacgacgggcgcacgatccgctacccagacccactcatcaaggccaacgacaccatc
aagattgacttggagaccaacaagatcgtggacttcatcaagtttgatgttggaaacatc
gtgatggtgaccggtgggaggaacacggggcgcgtcggggtgatcaagagcagggagaag
cacaagggcagctttgagaccatccatgtcgaggatgccctcggccaccagttcgcgact
cgcatgggcaacgtcttcaccatcggcaaggagaggaagccgtgggtatctctccccaag
ggcaagggcatcaagctcagcatcattgaggaggcgaggaagcgcaatgccgaggctgcc
gctgaggcttga

DBGET integrated database retrieval system