KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326033
Entry
4326033           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: leucine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4326033
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4326033
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4326033
   03029 Mitochondrial biogenesis [BR:osa03029]
    4326033
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     4326033
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4326033
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4326033
 Prokaryotic type
    4326033
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4326033
SSDB
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1f
Other DBs
NCBI-GeneID: 4326033
NCBI-ProteinID: XP_015621237
LinkDB
Position
1:complement(1145825..1155143)
AA seq 952 aa
MAVAMMQTPLQLRLQPRPPAVVAARHRRRLQSGFPPPNPRRGGGWCRCCANADAGKAQAQ
ARRAYPYDEIEPRWQRHWEEHRTFRTPDIGHGLDTSKPKCYILDMFPYPSGAGLHVGHPL
GYTATDILSRFKRMQGFNVLHPMGWDAFGLPAEQYAIETGTHPKITTERNINRFRSQLKS
LGFSYDWDREISTTEPTYYKWTQWIFLQLLKRGLAYQAEVPVNWCPALGTVLANEEVIDG
VSERGGHPVIRKPMRQWMLRITSYADRLLEDLDELDWPESIKEMQRNWIGRSEGAELEFS
AVDKEGHDLGANLLVYTTRPDTIFGATYVVLAPEHSLLSSLISEEQRVHVEEYIELTARK
SELERTDLQKEKTGVFSGSYAKNPATGEIVPIWVADYVLGSYGTGAIMAVPAHDSRDHEF
ALKYKLPIIKVVSPLNGNCDSEEAYADDGIMINSSSSSSGLNIDGMLSKDAALKVTEWVE
ANGFGKKKVNYKLRDWLFARQRYWGEPFPVIYRDDTNEMLPLQENQLPLTLPELDDFTPT
GTGEPPLTKATDWVKTVEPLSGKPARRETSTMPQWAGSCWYYLRFMDPQNASMLVDKAKE
SYWGPVDIYVGGAEHSVLHLLYARFWHKVLYDIGVVSTKEPFKCLINQGLILGEVEYTAY
RDNKGRWVSADSNSSLIDCYQEKVPADKVTKVGDHYVLKDDANIRLNARAYKMSKSRGNV
INPDDVVSEYGADSLRLYEMFMGPLRDSKTWSTGGIEGVHRFLGRTWRLVVGTPLPDGSY
GVGTTVTDEEPTLDQLRVLHKCIARVTEEIQETRFNTAISAMMEFVNAAYKWDTQPKSVI
ESFILLLSPFAPHMAEELWFRLGNSRSLAHEQFPEGKSEYLKESKLVLPVQINGKTRGTI
LVDKECSEDDAFQIAASDEKLSKYLTGKGIRKRIYVPGRILNVILDKQKART
NT seq 2859 nt   +upstreamnt  +downstreamnt
atggcggtagcgatgatgcagacgccgctccagctccggctgcagccgcggcccccggcc
gttgttgctgcccgccaccgccgccgcctgcaaagcgggttcccgccgccgaatccgcgg
cgaggtggtgggtggtgccgctgctgcgcgaacgccgacgccgggaaggcgcaggcgcag
gcgaggagggcgtacccgtacgacgagatcgagccgaggtggcagaggcactgggaggag
caccgcacgttccgcaccccggacatcggccacggcctcgacacctccaagcccaagtgc
tacatcctcgacatgttcccctaccccagtggagctgggctgcatgttgggcatcccctt
gggtacacggcaactgacatcctgtcgaggttcaagcgcatgcaaggcttcaatgtgttg
catccgatgggatgggatgcatttggtcttcctgcggagcagtatgctatcgagacggga
acccaccctaagattaccactgaacggaacatcaatcgattccgctcacagctcaaatcg
ttaggtttttcatatgactgggatcgtgaaatttccacaacggaaccgacttactacaaa
tggacacaatggattttccttcaactactgaaaagaggactggcctatcaggctgaggta
ccggttaattggtgccctgctcttggaactgttctggcgaatgaagaagtaatagatggt
gtcagtgaacgtggtggtcatcctgttatacgaaagccaatgcgccagtggatgctgagg
attacatcttatgctgatcgacttcttgaagatttggatgaacttgattggcctgagagc
atcaaagaaatgcaaagaaactggatagggagatcagaaggcgctgagcttgaattctca
gctgtggacaaggaagggcacgatctaggtgctaatttgttagtttacacaacaagacct
gacacaatttttggtgcaacatatgttgttctggcacccgagcattctctattgtcatct
ctaatttctgaggaacaacgtgtacatgtagaggaatacatagaactcacagcaagaaag
agtgaactggaaagaactgatcttcagaaggaaaaaactggagtttttagtggttcttat
gctaagaacccagcaactggggagatagttccaatatgggtggcagattatgttttagga
agctatggcactggggctatcatggctgtgcctgcacatgactcacgtgaccatgaattt
gccttgaaatataaacttccaatcattaaggttgtaagtccactcaatggcaattgtgac
tctgaggaggcatatgcagatgatggtatcatgataaactcatccagttcttcatctgga
ttaaatattgatggtatgctttccaaggatgctgctttgaaagttactgaatgggtagag
gctaatggctttggaaagaaaaaggtgaactacaagcttcgagattggctctttgctaga
cagcgttattggggtgaacctttccctgtgatttaccgtgatgataccaatgaaatgctg
ccccttcaagaaaaccagttgcctttaactcttcctgaattggatgatttcactccaact
ggtactggagagcctcctctgaccaaggcaacagattgggttaaaaccgtagaacctttg
tctgggaagcctgctagaagggaaacaagcaccatgccacaatgggctggatcatgctgg
tattatttgagatttatggatcctcaaaatgccagtatgttggttgacaaggcaaaagag
agttattggggcccagttgacatctatgttggtggtgctgaacattctgtcttgcatttg
ctttatgcaagattttggcataaggttctttatgatattggcgtagtttccactaaagag
cccttcaagtgcctgataaatcaaggattgattctaggagaagttgaatatactgcatat
agagacaataaagggagatgggtttctgcagattccaactcaagtttgattgattgctac
caagaaaaagtacctgcagataaggtcacaaaagttggagatcattatgtactgaaggat
gatgcaaacatacgtctaaacgctcgtgcttataaaatgagtaaaagtcgaggaaatgtc
atcaacccagatgacgtggtttcagaatatggtgctgattctctccgcttatatgaaatg
ttcatgggaccactgagagattcaaaaacatggagcactggtggaattgaaggtgtgcat
agatttctaggaaggacatggagactcgtagttggtacaccattaccagatggatcatat
ggagttggaactacggttactgatgaggaaccaaccttggatcagctccgagttcttcac
aaatgcattgcaagagtcacagaggaaattcaagaaacaagatttaacactgcaatttct
gcaatgatggaatttgtgaatgctgcatacaagtgggacacccaaccaaagtcagttatt
gaatcctttattctgttgctttcgccttttgcaccacacatggctgaggagctttggttt
cgccttgggaactcaagatcattggcccacgagcaatttccagagggaaaaagtgagtac
ttgaaagaatcaaagctcgtgcttccagtgcaaatcaatgggaagaccaggggtacaatt
cttgtcgacaaagagtgctctgaggatgatgcattccaaatagcagcctccgacgagaaa
ctctccaaatatttgactgggaagggcatcaggaagagaatttatgtgcctggaaggatt
cttaatgttatactagataaacagaaggcaaggacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346920
Entry
4346920           CDS       T01015                                 
Name
(RefSeq) leucine--tRNA ligase, cytoplasmic
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4346920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4346920
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4346920
   03029 Mitochondrial biogenesis [BR:osa03029]
    4346920
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     4346920
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4346920
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4346920
 Prokaryotic type
    4346920
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4346920
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e
Other DBs
NCBI-GeneID: 4346920
NCBI-ProteinID: XP_015612118
UniProt: A3BYB3 Q6H4P7
LinkDB
Position
9:complement(12730770..12735697)
AA seq 1094 aa
MSSNPDGGRSFARRDQLLNIQSDVHKLWEEGKVFEAEPGSKPPGPGEKFFGNFPYPYMNG
LLHLGHAFSLSKLEFGAAYHRLRGSNVLLPFAFHCTGMPIKASADKLSREAQQYGYPPVF
PELDSSIEVADDSQPDQGVSVAPDKFKSKKSKAASKVGLQKFQWEIMRGFGLSDEEIAKF
RDPYHWLSYFPPLAKEDLKAFGLGCDWRRSFITTDMNPFYDAFVRWQMRKLKKMGKVVKD
MRYTIYSPLDGQPCADHDRASGEGVQPQEYVLIKMEVVPPFPPNLKTLEGRKVYLAAATL
RPETMYGQTNCWVLPDGKYGAFEINDTDVFVLTSRAALNLAYQGLSKVPEKPTCLAELSG
NDLIGLPLKSPLSFHDVIYALPMLTILTDKGTGIVTSVPSDSPDDFMALQDLVSKPALRQ
KFGVKDEWVLPFKIIPIINIPEFGDKSAEKVCLDLKIKSQNDKEKLAEAKRMTYLKGFTD
GTMIVGEFNGRKVQEAKPLIKKQLLEEGTAVLYSEPEKKVMSRSGDECVVALTDQWYITY
GGTEWKQKAVKCLEKMNTFSAETRNGFEHTLGWLNQWACSRSFGLGTRIPWDEQFLVESL
SDSTLYMAYYTIAHLLQNGNMYGKEIFSIRPEQMTDEVWDYVFCDGLAPTTDIPPALLSK
MKQEFEYWYPFDIRVSGKDLIQNHLTFSIYNHTALLPEHHWPRGFRCNGHLMLNSEKMSK
STGNFRTLRQAIEEFSSDATRFALADAGDGMDDANFVFETANAAILRLTKEIAWMEEVIA
AESSLRTGPPSTYADHVFANEINIAVIETEKSYNAFMFRDALKLGFYDLQLARDEYRLSC
GAAGMNRDLLWRFMEVQTRLITPICPHYAEHVWQKILRKEGFAIKAGWPVAGSPDPTLRI
ANKYLQDSIVKFRKLLQKQESGSKKPKKGAAAPPPSEENKLTVGLIYVNEHYYGWKEQCL
RVLQSKFDSQARSFAPDEEITEALKNCSIGQETNFKQVQKLCMPFIKSKKDEAKSVGPHA
LNLKLPFGEMNVLEENLELIKRQVGLDHVEVLSASDEATRAKAGAHVSMLDKTPPSPGEP
VAIFISKQEFEAQH
NT seq 3285 nt   +upstreamnt  +downstreamnt
atgtcgtcaaatcctgatggaggcagaagttttgctcggagagatcaattactcaatatc
caatcagatgttcacaagttatgggaggagggcaaggtttttgaggctgaacctgggagt
aagccaccaggccctggggaaaaattctttggcaattttccatacccttacatgaacggc
ttgctacatttgggccatgccttctcattgtccaagcttgagtttggtgctgcataccat
agactccgtggctcaaatgtccttttgccttttgctttccattgtacgggaatgcccatc
aaggcctcagcagataaactgtcaagggaggctcaacaatatggatatcctcctgtgttt
cctgaattagactcaagtattgaagttgctgatgatagccagcctgaccagggggtttct
gttgccccagataaatttaagagcaagaaatctaaggctgcttcaaaggttggcttacag
aagtttcagtgggagatcatgagggggtttggattgtcagatgaagaaattgctaaattc
cgggacccttaccactggttatcttacttccctccattggcaaaggaggacctcaaggcc
tttggcctgggttgtgattggaggaggtcgttcataactactgacatgaacccattctat
gatgcttttgtccggtggcagatgagaaagctgaagaaaatgggcaaggttgtcaaagat
atgaggtacacaatctactctccattggatggccaaccttgtgctgaccatgatcgagct
tcaggtgaaggtgtacagcctcaggagtatgtgttaattaaaatggaggtggttccacct
ttcccacccaacttgaagaccttggaaggaaggaaagtttatttggcagcagctacctta
agacccgagacgatgtatgggcagacaaactgttgggtattacctgatggaaaatatggt
gcttttgagatcaatgacaccgatgtcttcgttctgacatcaagggccgcccttaatctt
gcataccagggtctatctaaggtcccagagaagccaacttgcttagctgagctatctggc
aatgatctgattggtttgcccttaaagtcccctctttcttttcatgacgttatatacgca
cttcccatgctcactatcttgacagacaaaggcactggcattgtgactagtgtgccaagt
gattctccagatgatttcatggcactacaagatttagtatcaaagccagctttgagacaa
aagtttggagtcaaagatgagtgggttcttccatttaagattataccaataatcaatatt
cctgaatttggagataagtcagctgagaaggtgtgccttgatctcaagattaaaagccag
aatgacaaggagaaacttgcggaagctaaaaggatgacatatctcaaaggttttactgat
ggaacaatgattgtaggggagttcaatgggagaaaggttcaagaagcaaagccactgata
aagaagcagcttttggaagaaggcacagcggtgctgtatagcgagcctgagaagaaagtc
atgtcaagatctggtgatgagtgtgttgttgctctcacagatcagtggtacattacttat
ggtgggactgaatggaagcagaaggcagtcaaatgtttggagaagatgaatacattctcg
gcagaaacccgtaatggttttgaacacacattaggctggctgaatcagtgggcttgctct
cggtcttttggcctaggtactcgcattccatgggatgagcagttcctcgtggaatctctt
tctgattccaccctctatatggcatattacacaattgctcatcttttgcaaaatggtaac
atgtatggtaaggaaatattttctattagaccagaacaaatgacagatgaagtttgggac
tatgtgttctgtgatggtctggcacctactactgacatacctccagctctcttgagtaaa
atgaagcaagaattcgagtattggtatccctttgatattcgggtgtctggcaaggatctt
atccaaaaccatctgacattcagcatttacaaccatacagcacttcttccggagcatcat
tggccccgtggcttccgttgcaatgggcatcttatgcttaattctgagaagatgtccaag
tccacagggaatttccgtactcttcggcaggccattgaagaattctcttctgatgccact
aggtttgcccttgctgatgctggtgatggtatggatgatgccaattttgtctttgaaaca
gcaaatgctgctattttgaggcttaccaaagaaattgcatggatggaagaggttatagct
gctgaatcttcccttagaactggacctccctctacttatgctgaccatgtgtttgctaat
gagattaacattgcggtgatcgaaactgagaagagctacaatgccttcatgttcagagat
gcccttaagttggggttctatgacttacaattggctagagacgagtacagactttcttgt
ggagcagcaggcatgaatcgtgatttgttgtggcggtttatggaagttcagactaggctt
atcacccccatttgcccacactatgctgagcatgtgtggcaaaagatcctgaggaaggaa
ggctttgcaataaaagcaggctggccagttgcaggaagcccagatcctactctaagaatt
gcaaacaaatatttacaggactctatagttaaattcaggaagctgctccagaagcaagaa
tccggttccaagaagcccaagaagggagctgctgcacctcctccatctgaggaaaacaag
ctgactgttggtctgatctatgttaatgaacactattatggatggaaagagcaatgtctg
agggtgctccagtctaaatttgacagccaagctcggtcctttgcccctgatgaggagatt
actgaagcactgaagaattgctccatcgggcaggaaactaatttcaaacaagtccagaag
ctctgcatgcctttcatcaagtcgaaaaaggatgaggccaagagtgttgggccccatgct
ttaaatctgaagcttccatttggtgaaatgaatgttctcgaggagaatttggagttgatc
aagaggcaggtaggccttgaccatgtagaggtcttgtcagcttctgatgaagcaactcgt
gctaaggctggtgctcatgtttcaatgttggacaagaccccgccttctcctggtgaacca
gtagcaatcttcatcagcaagcaggagtttgaagcccagcactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347497
Entry
4347497           CDS       T01015                                 
Name
(RefSeq) leucine--tRNA ligase, cytoplasmic
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4347497
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4347497
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4347497
   03029 Mitochondrial biogenesis [BR:osa03029]
    4347497
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     4347497
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   4347497
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    4347497
 Prokaryotic type
    4347497
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4347497
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e
Other DBs
NCBI-GeneID: 4347497
NCBI-ProteinID: XP_015611831
UniProt: A0A0P0XP69 Q0J0N6
LinkDB
Position
9:19472456..19477140
AA seq 1095 aa
MSSNPDGGRSFARRDILLKIQSDAQKWWEESKVFEAEPGNKPPGPGEKFFGNFPYPYMNG
LLHLGHAFSLSKLEFGAAYQRLRGSNVLLPFAFHCTGMPIKASADKLSREAQQYGYPPAF
PEVEDDSSAEVADSSQADNAASVVPDKFKSKKSKAASKVGMQKFQWEIMRGFGLSDEEIA
KFQDPYHWLTYFPPLAKEDLKAFGLGCDWRRSFITTDMNPFYDAFVRWQMRKLKKMGKVV
KDMRYTIYSPLDGQPCADHDRASGEGVQPQEYVLIKMEVVPPFPPKLKTMEGRNVYLAAA
TLRPETMYGQTNCWVLPDGKYGAFEINDTDVFIVTSRAALNLAYQNLSRVPEKPTCLMEL
SGCDLIGLPLKSPLAFNEIIYALPMLTILTDKGTGIVTSVPSDSPDDFMALQDLVAKPAL
RQKYGVKDEWVLPFKVVPIINIPEFGDKSAEKVCLDLKIKSQNDKEKLAEAKRMTYLKGF
TDGTMIVGEFNGRKVQEAKPLIKNKLLEEGTAVLYSEPEKKVMSRSGDECVVALTDQWYI
TYGETEWKQKAVQCLEKMNTFSAETRNGFEHTLGWLNQWACSRSFGLGTRIPWDEQFLVE
SLSDSTLYMAYYTIAHLLQNGNMYGKEISSIRPEQMTDEVWDYVFCDGPAPNSDIPPALL
SKMKLEFEYWYPFDIRVSGKDLIQNHLTFSIYNHTALLPEHHWPRGFRCNGHLMLNSEKM
SKSTGNFRTLRQAIEEFSSDATRFALADAGDGMDDANFVFETANAAILRLTKEIAWMEEV
IAAESSLRAGPPSTYADHVFANEINIAVIETEKSYNAFMFRDALKLGFYDLQLARDEYRL
SCGAAGMNRELLWRFMEVQTRLITPICPHYAEHVWRNILRKEGFAIKAGWPIAGTPDPTL
RIANKYLQDSIVKFRKLLQKQESGSKKPKKGTAPPPSEQNKLTVGLVYVNENYYGWKEQC
LRVLQSKFDSQARLFAPDEEINEALKNCSIGQETNFKQVQKLCMPFIKSKKDEARSVGPH
ALNLKLPFGEMSVLEENLELIKRQVGLEHAEVLSASDEAARAKAGVHASMLDKTPPSPGE
PVAIFMSKLDLEARC
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgtcatcaaatcctgatggaggcagaagttttgctcggagagatattttactcaagatc
cagtcagatgctcaaaaatggtgggaggagagcaaggtttttgaggctgaacctgggaat
aaacctccgggccctggggaaaagttctttggcaactttccatatccttacatgaatggc
ttgctacatttgggccatgcgttctccttgtctaaacttgagtttggtgctgcatatcag
aggcttcgtggttcaaatgttcttttgccatttgctttccactgtacgggaatgcccatc
aaggcctcagcagataaactctctagggaggcgcaacaatatggatatcctccagcgttt
cctgaagtagaggatgattcaagtgcagaagttgctgatagtagccaggctgacaatgcg
gcttctgttgtcccagataaatttaagagcaagaaatctaaggctgcttcgaaggttggc
atgcagaagtttcagtgggagatcatgagaggctttggcttatcagatgaagaaatcgcc
aaatttcaggatccttaccactggttaacttacttccctccattggcgaaggaggacctc
aaggcctttggtctgggctgtgattggaggaggtcattcataactactgacatgaacccc
ttctatgatgcatttgtccggtggcaaatgagaaagctgaagaaaatgggcaaggttgtc
aaagatatgaggtacacaatctactctccattggatggtcaaccttgtgctgaccatgat
cgagcatctggtgaaggtgtacagccacaagaatatgtgttaattaaaatggaagttgtt
ccaccttttcctcccaagttgaagaccatggaaggaagaaatgtttatttggcagcagcc
acattgagacctgagacaatgtatgggcagacaaactgttgggtattgcctgatggaaaa
tatggggcctttgagatcaatgacactgatgtcttcattgttacatcaagggctgctctt
aatcttgcatatcagaatctatcaagggtcccagaaaaaccaacttgcttaatggagtta
tctggttgtgatctgattggtttaccactgaaatcccctcttgccttcaatgagatcata
tatgcacttcccatgcttactatcttaacagataaaggtactggcattgtgactagtgtc
ccaagtgattctccagatgatttcatggcactacaggatttagtcgcaaagccagctttg
agacagaagtatggtgtcaaagatgaatgggttcttccctttaaggttgtaccaataatc
aacattcctgaatttggagacaagtctgctgagaaggtgtgcctcgatcttaagattaag
agtcagaatgacaaggagaagcttgctgaagcaaaaaggatgacatatctgaaaggtttt
actgatgggacaatgattgtaggggagttcaatggcagaaaagttcaagaagcgaagcca
ctgataaagaacaagcttttggaagaaggcacagcagtgttgtatagcgagcctgagaag
aaagttatgtcgagatctggtgatgagtgtgttgttgctctcacagatcaatggtacatt
acttatggtgagactgaatggaagcagaaggcagttcaatgcttggagaagatgaataca
ttctcagctgaaactcgtaatggttttgaacacacgttaggctggctgaaccagtgggcc
tgctctcgttcttttggcctaggtactcgcattccatgggatgagcagttccttgtagaa
tctctttctgattccaccctctacatggcatattacacaatcgctcaccttttgcaaaat
ggcaacatgtatggcaaggaaatatcttctatcagaccagaacaaatgacagatgaagtc
tgggattatgtgttctgtgatggtccagcacccaatagtgacatccctcctgccctcttg
agcaaaatgaagctggaatttgagtactggtatccatttgatattcgtgtctctggtaag
gatcttatccaaaaccatctgactttcagcatttacaatcatacagcacttcttccagag
catcattggcctcgtggtttccgctgcaatggacatcttatgcttaattctgagaagatg
tccaagtccacagggaatttccgaactcttcgacaggccattgaagaattctcttctgat
gccactagatttgcccttgctgatgccggtgatggtatggatgatgcaaactttgtcttt
gaaacagcaaatgctgctattttgaggcttacaaaagaaattgcatggatggaagaggtt
atagccgctgaatcttctctgagagctgggcctccctctacctatgctgaccatgtgttt
gccaacgagataaacattgcggtgatagaaactgagaagagctacaatgccttcatgttc
agagatgcccttaagttggggttctatgacctacagttggctagagatgagtacagactc
tcttgtggagcagcaggcatgaatcgtgaattattatggcggttcatggaggtgcagact
aggctcattacccccatttgtccacactatgctgagcatgtgtggcgaaacatcctgagg
aaggaaggatttgcaataaaggcaggctggccaattgctggaaccccagatcccacacta
agaattgctaacaaatatttacaggactccatagttaaattcaggaagctgctccagaag
caagaatctggttccaagaaacccaagaagggaactgcacctcctccatctgagcaaaac
aagctgactgttggtctggtctacgtcaatgagaactattatggatggaaagagcaatgt
ttgagggttctccagtctaaatttgatagccaagcacgtttgtttgctcctgatgaggag
attaatgaagcattgaagaactgctccatcggacaggaaactaacttcaaacaagtccag
aagctctgcatgcctttcatcaagtcgaaaaaagatgaggcgaggagtgttgggccccac
gctttgaatttgaagcttccttttggtgaaatgagtgttctcgaggagaacttggagctg
atcaagaggcaggtaggccttgaacatgcagaggtcctgtctgcttctgatgaggctgct
cgtgctaaagctggcgtgcatgcttctatgctggacaagaccccgccttctcctggtgag
ccagtagcaatcttcatgagcaaactagacctcgaagcgcggtgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272228
Entry
9272228           CDS       T01015                                 
Name
(RefSeq) leucine--tRNA ligase, cytoplasmic
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    9272228
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    9272228
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    9272228
   03029 Mitochondrial biogenesis [BR:osa03029]
    9272228
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     9272228
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   9272228
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    9272228
 Prokaryotic type
    9272228
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    9272228
SSDB
Motif
Pfam: tRNA-synt_1 tRNA-synt_1g tRNA-synt_1e
Other DBs
NCBI-GeneID: 9272228
NCBI-ProteinID: XP_015637616
UniProt: B7F5U8 Q60EU9
LinkDB
Position
5:8590560..8597040
AA seq 478 aa
MLSRVPEKPTCLVELLGTDLIGLPLKSPLASNEVIYVLPMQNILVDKGTGIVTSVPSDTP
DDFIALQELVKNQDFRVACGVKDEWVFPFEVIPIIDVPSFGNKSAEKVCFDLKMDSPDEK
EKLAKAKEITYLKGFDDGIMIVGEFSNRKVQEVKPLIKEKLLKADMAVLYYEPQEKVISR
SGDDCVVALTDQWLITYGEAEWKQKAIECLDKMNTFSVEARNSFEHTLNWLTSRARSCSF
GLGTRIPWDEKFLVDSLSDSTLYMAYYTIAHILQNGNIYGSDNSYIRPEQMTDEVWDYVF
CNGPAPKTSIPSTVLTKMKQEFEYWYPFDLRISGKDLMQNHLAFCIFNHTTLLPKHHWPR
GFRCNRHLLLNSEKMSKSTGNFRTLRQAIEEFSSDATRFALADVGDGMDDENFVSETANS
AALRLTKEISWMKEVFDDKSSFRLGPPSTYADRVFANEINFAIKDTEIIMMLPCFEML
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgctatccagagttccagaaaagccaacttgcttagttgagctgcttggcacagatctg
attggtttgccattgaagtcacctcttgcctccaacgaagtcatatatgttcttccaatg
cagaacatattagtagataaaggcactggaattgtgactagtgttccaagtgatacaccg
gatgatttcatcgcattacaagagttggtaaaaaatcaagattttagagtggcatgtgga
gtgaaagatgagtgggttttcccctttgaagttataccaataattgatgttccaagtttt
ggaaataaatcagcagagaaggtttgttttgatctgaaaatggatagtccagatgagaaa
gaaaaacttgctaaagcaaaagagatcacatatttgaaaggcttcgatgatggcataatg
attgttggtgagtttagcaaccgaaaggttcaagaagtgaagccattgataaaggaaaag
ctattgaaggcagatatggctgttttgtactatgagcctcaggagaaggtcatttccagg
tcaggtgatgactgtgttgttgctctcacagatcaatggctcataacatatggtgaggct
gaatggaaacaaaaggctatagaatgcttggacaagatgaatacattctcagttgaagcc
cgtaatagttttgagcacacattgaactggctgacttcacgggcccgttcatgttctttt
ggactaggtactcggattccatgggatgagaagtttcttgtagattctctttctgattca
actttgtacatggcctactacaccattgcacatatactgcaaaatggtaacatttatgga
tctgacaactcttatataaggccagaacaaatgactgatgaagtatgggattatgtgttc
tgtaatggtccggcaccaaaaactagcatcccctctactgttttgacaaaaatgaagcaa
gagtttgagtactggtatcccttcgatcttcgaatttcaggtaaggaccttatgcagaac
catctggccttctgtatcttcaatcacacaacacttcttccaaaacatcattggccccgc
ggattccgttgcaacagacaccttctgcttaattctgagaagatgtctaagtccacagga
aatttcaggacccttcgacaggccatagaggaattttcgtctgatgccactaggtttgca
cttgctgatgttggtgacggtatggatgatgaaaactttgtctctgagactgcaaattct
gctgcactaagactgacaaaagaaatttcatggatgaaagaagtttttgatgataaatct
tcctttcgacttgggccaccatctacttatgctgatcgcgtctttgctaacgagataaac
tttgccatcaaagacacggaaataattatgatgcttccatgttttgagatgctctaa

DBGET integrated database retrieval system