KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326076
Entry
4326076           CDS       T01015                                 
Name
(RefSeq) CDP-diacylglycerol--serine O-phosphatidyltransferase 1 isoform X4
  KO
K08730  phosphatidylserine synthase 2 [EC:2.7.8.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4326076
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.29  L-serine-phosphatidylethanolamine phosphatidyltransferase
     4326076
SSDB
Motif
Pfam: PSS LYRIC
Other DBs
NCBI-GeneID: 4326076
NCBI-ProteinID: XP_015626869
UniProt: Q0JR55
LinkDB
Position
1:1046310..1053180
AA seq 425 aa
MEVNGHHKPRREYNGRECNGVQSVNNFGDIDPWTAWAYKPRTVSLLLMGTCFLIWASGAL
DPERSFSVDRVSSVKRGVFAMIAVFLAYSFLQAPSTVLIRPHPAIWRLVHGMAVVYLVAL
TFLLFQTRDDARQFMKYLHPDLGVELPERSYGTDCRIYVPDHPKSRFNNVYEILFDEFVI
AHILGWWGKAIMIRNQPLLWVLSIGFELMELTFRHMLPNFNECWWDSIVLDILICNWFGI
WAGMKTVRYFDGRTYEWVGLSRQPNIISKVKRTLGQFTPAQWDKDEWYPLLGPWRFIQVL
SLCIVFMIVELNTFFLKFCLWIPPRNPLIVYRLVLWWLIAIPTIREYNTYLQDRKPVKKV
GSFCWLSLAICILELLLCIKFGHGLFPKSMPSWLFIAWTTVASLLMMFLLVWTWKIYRTM
IRKRL
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggaggtcaatggtcatcacaaaccaagaagagaatataatggccgagagtgcaatggt
gtacaatcagtaaacaattttggcgatatcgatccatggacagcatgggcatacaaaccg
cgcacagtttcattgctactgatgggaacatgctttttaatttgggcaagtggtgctctt
gatccagaaagaagcttctctgttgaccgcgtttcatctgttaaaaggggtgtctttgca
atgattgctgtttttttggcttattcatttcttcaggcaccttctactgtacttattaga
ccacatcctgccatttggcggctggtccacgggatggcagttgtttaccttgttgctcta
acttttttgcttttccagacccgtgatgatgctaggcaatttatgaagtatcttcaccct
gatcttggtgttgaattacctgaaagatcttatggaaccgactgccgcatatatgtacct
gatcatccgaaaagcaggtttaacaatgtttatgagatcctttttgatgagtttgttatt
gcccatatccttggatggtgggggaaggctataatgataagaaaccaaccacttttatgg
gtattatcaattggctttgagctaatggagctcacctttcgccatatgctgccaaacttt
aatgagtgttggtgggatagcatcgtactagacatattaatctgcaattggtttggtatt
tgggctggaatgaagactgtgagatactttgatgggaggacatatgaatgggttggtttg
agtcgtcaacccaatattatcagtaaggtaaaaaggacgctaggccagttcacaccagca
cagtgggacaaagatgagtggtaccctctgcttggcccttggagattcatccaggtgctg
agcctatgtattgttttcatgattgttgaacttaacacattctttctcaagttctgcctt
tggattcctccccgaaaccccttgattgtttaccgacttgtcctttggtggttaattgcg
ataccaaccattcgcgagtacaatacatacttacaagacaggaaacctgttaaaaaggtg
gggtctttctgttggctttccctagctatttgcattttggagcttctactatgcatcaag
tttggacatggtctctttccgaagtcgatgccgtcatggttgttcatagcctggacgacc
gtggcgtcgcttctgatgatgttccttcttgtgtggacttggaaaatttaccgaacaatg
ataaggaaaaggctatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339554
Entry
4339554           CDS       T01015                                 
Name
(RefSeq) CDP-diacylglycerol--serine O-phosphatidyltransferase 2
  KO
K08730  phosphatidylserine synthase 2 [EC:2.7.8.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4339554
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.29  L-serine-phosphatidylethanolamine phosphatidyltransferase
     4339554
SSDB
Motif
Pfam: PSS Oxidored_q2 DUF5079
Other DBs
NCBI-GeneID: 4339554
NCBI-ProteinID: XP_015637466
UniProt: Q6I628
LinkDB
Position
5:27552411..27558240
AA seq 423 aa
MEAKQRTRHRDGEERRLVAAADGGAEEYDPWTAWLYKPHTISVLLVGACLLIWASGALDP
EGASYHSSATSIKRGVWAMIAVFLAYCTLQAPSTILIRPHPAVWRLVHGLAVVYLVALAF
LLFQNRDDARQFMKHLYPDLGVELPERSYGADCRLYVPENPKNKFINIYETLFDEFVVAH
ILGWWGKAVMIRNQLLLWVLSIGFELMELTFRHMLPNFNECWWDSIILDILICNWFGIWA
GMHTVRYFDGKTYEWVGLSRQPSIMGKVKRSLSQFTPAQWDKDQWYPFMGPLRFVQVLFL
CVVFMTVELNTFFLKFCLWIPPRNPLVVYRLILWWLIAIPTIREYNSYLQNSKPVKKVGA
FCWLSLAICIVELLICMKFGHGLFHDPMPTWLIIFWSSVGVALVVFLLAWSWRNHLKYQR
KRL
NT seq 1272 nt   +upstreamnt  +downstreamnt
atggaggcgaagcagaggacgaggcatcgcgacggagaggagaggaggctcgtagcggcg
gcggatggcggcgccgaggagtacgacccatggacggcgtggctctacaagccgcacacc
atctcggtgctcctcgtcggtgcttgccttctaatttgggcaagtggagcgcttgatcca
gagggtgcttcttatcacagtagtgcgacatctattaagaggggtgtctgggctatgatt
gcagtcttccttgcttactgcactctccaagcaccttcaacgatacttattaggccccat
cctgctgtctggcgcctggtgcacggactggctgtcgtttaccttgtcgctctagccttt
cttcttttccagaaccgcgatgatgctcgccagttcatgaaacacctttaccctgatctt
ggagttgaattgccggagagatcttatggagctgactgccgtctgtatgttccggaaaac
cctaaaaacaagttcataaatatttatgagacattatttgacgaatttgtggttgcccat
attttgggttggtggggtaaagccgtaatgatacgaaaccagcttcttctttgggtcctc
tcgattggtttcgagctaatggagcttacattcagacatatgttgccaaactttaatgag
tgctggtgggatagtattattttggatatcttgatctgcaactggtttggtatatgggcg
gggatgcacacagtccgttactttgacggtaaaacatatgagtgggttggactgagccga
cagccaagcatcatgggcaaggtgaaaagatcactgagccagttcacccctgcacaatgg
gacaaggatcaatggtaccctttcatggggccgttgcggttcgttcaagtgttgttcctg
tgcgttgttttcatgacagtggagctcaacacattttttcttaaattttgcctctggatt
cctccaaggaatcctttggttgtgtacagattaatcctatggtggttgattgctattcca
accatccgtgagtacaactcctacttgcaaaacagcaaaccggtgaagaaggttggggct
ttttgctggctctctctagctatatgcattgtagagcttcttatatgtatgaagtttgga
catgggctgtttcatgatcccatgcctacttggttgatcatcttttggagttcggtgggg
gtagcactagtggttttcttgcttgcatggtcttggaggaatcacctgaaatatcagaga
aagcggctataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271420
Entry
9271420           CDS       T01015                                 
Name
(RefSeq) CDP-diacylglycerol--serine O-phosphatidyltransferase 3-like
  KO
K08730  phosphatidylserine synthase 2 [EC:2.7.8.29]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    9271420
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.29  L-serine-phosphatidylethanolamine phosphatidyltransferase
     9271420
SSDB
Motif
Pfam: PSS
Other DBs
NCBI-GeneID: 9271420
NCBI-ProteinID: XP_015612913
LinkDB
Position
1:complement(28166386..28173194)
AA seq 487 aa
MPVRRRWYPPSSTAAQPSPDGGDVNTDDADACPSSRQQRPPSLPQHSAPIHHRRRVINSI
DASGEVMEYGSSNDQRMQDMEIWPSDGGGVEEYDPWTAWLYKPHTVSVLLAGACLLIWAS
GVLHPEITSSHDKVIPIKRGVWAMIAVFLAYCTLQAPSTILIRPHPAVWRLVHGMAVVYL
VALTFLLFQKRDDARQFMKHLHPGLGVELPERSYGSDCRMYVPENPTNRFINIQETLFDE
FVIAHVLGWWGKAVMIRNQLLLWVLSVGFELMELTFRHMLPNFNECWWDSIILDIMICNW
FGIWAGMHTVRYFDGKTYEWVGLSRQPSIMGKVKRSLCQFTPAKWDKDQWHPFMEPRRFI
QVFCLCVGFMTVELNTFFLKFCLWIPPRNPLVVYRLILWWLIAIPAIREYNTYLQDRKPV
KKVGAFCWLSLAICMVELLICMKFGHGLFQDPMPTWLITLWICVGISLALFLLEWSRRDH
LRSIKQL
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgccagtgcgtcggaggtggtaccccccgagctccaccgcagcccagcccagcccagat
ggaggcgatgtaaacacagatgacgccgacgcctgcccatcttctcgacagcagagaccg
ccgtcgcttccacagcattcggctcccatccatcaccgtagacgagtaatcaactccatt
gatgccagcggtgaggtgatggaatatggatctagtaacgatcagaggatgcaggacatg
gaaatatggccgtcggacggcggcggcgtggaggaatacgacccgtggacggcttggctt
tacaagccacacacggtctcggttctccttgccggcgcatgcctcctgatctgggcaagt
ggggtccttcatccagagattacaagctctcatgataaggtcatacctattaaaaggggt
gtctgggctatgatcgcagttttcctagcatactgcactctccaagcaccttcaacgata
cttattaggcctcatcctgctgtgtggcgtttggtgcatggcatggctgttgtgtacctt
gttgctctaacttttcttcttttccagaaacgtgatgatgccaggcagtttatgaagcac
cttcaccctggtctcggagttgaactaccagagagatcatatggttctgactgccgtatg
tatgttccagaaaaccctaccaacagatttattaatattcaagagacattgtttgatgaa
tttgttattgcccatgtcttgggttggtggggtaaggcagtaatgatacggaaccaactt
ctcctatgggtcttgtcagttggttttgagctcatggagcttacatttaggcacatgctg
ccaaattttaacgagtgttggtgggacagtattatattggatatcatgatatgtaattgg
tttggtatttgggcggggatgcacacagtccgttactttgatggcaaaacatacgaatgg
gttggactgagccgtcagccaagcattatgggtaaggtaaaaaggtcattatgtcagttc
acacccgctaaatgggataaggatcaatggcatcctttcatggagccaaggagattcatc
caagtgttctgtctctgcgtcggtttcatgacagtggaacttaacaccttcttcctgaaa
ttttgtctctggattcctcccaggaaccccttggttgtgtatcggctgatcctttggtgg
ttaattgctatcccggcaattcgtgagtacaacacctacttgcaagacagaaaaccagtg
aagaaggtgggagctttttgttggctttcgttagctatatgcatggtagagctgcttata
tgcatgaagtttggacacggtttgtttcaagatccaatgcctacttggttgattactctt
tggatttgtgtggggatttctcttgcgcttttcttgctggaatggtcacgaagggatcac
ttacgctcaataaagcagctgtaa

DBGET integrated database retrieval system