KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326136
Entry
4326136           CDS       T01015                                 
Name
(RefSeq) acetyl-CoA acetyltransferase, cytosolic 1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00650  Butanoate metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4326136
   00630 Glyoxylate and dicarboxylate metabolism
    4326136
   00650 Butanoate metabolism
    4326136
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4326136
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4326136
   00310 Lysine degradation
    4326136
   00380 Tryptophan metabolism
    4326136
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4326136
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326136
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     4326136
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4326136
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Other DBs
NCBI-GeneID: 4326136
NCBI-ProteinID: XP_015621311
UniProt: A0A0P0UXB0 Q9ASK5
LinkDB
Position
1:549151..552597
AA seq 416 aa
MAPPPHSDSDLLKPRDVCIVGVARTPIGALLGSLSSLPATKLGSVAIQAALRRANVEPAL
VQEVFMGNVLSANLGQAPARQAALGAGLPDTVPCTTVNKVCSSGMKAVMLAAQTIQLGMH
DVVVAGGMESMSNAPKYVAAARRGSRFGHDVLIDGMLKDGLWDVYNDFPMGMCAELCADQ
HSISREEQDLYAIQSNERAIAARDSGTFSWEIAPVEISSGRGKPPLIVDKDESLAKFNSA
KLRKLGPTFKKNGSVTAGNSSSISDGAAAIVLVSGQKAKSLGLQVIARIRGYADAAQAPE
LFTTTPALAIPKAVSNAGLQTSQIDYYEINEAFSVVALANQKLLGIPSGKLNLSGGGVSL
GHPIGCSGARIIVTLLGILRHKNGKIGVAGVCNGGGGASALVVELMQPSLFTRSSL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggctcctcctccgcactcggactctgacctgctcaagccgagagacgtctgcatcgtg
ggcgtcgcccgcacgcccatcggcgccctgctcggctccctctcctccctccccgccacc
aagctcggctccgtcgccatccaggccgctctcaggagagcaaatgtggagccggcgctc
gtgcaggaggtcttcatggggaacgttctcagcgccaaccttggccaagccccggcgagg
caagccgccctaggcgccggcttgcccgacactgtgccctgcaccaccgtcaacaaagtt
tgctcctcggggatgaaggctgtcatgcttgcggcgcagactattcagcttgggatgcat
gatgttgttgtcgctggtgggatggagagcatgtccaatgcccccaaatatgtcgcggca
gcaagacgggggtcacggtttgggcacgacgtcctcatcgatgggatgctcaaggatggg
ctgtgggatgtgtataatgatttcccaatgggaatgtgtgccgagttgtgtgcggatcaa
cactccatttcaagggaggagcaggatctttatgctatccagagcaatgaacgtgcaata
gcagctcgtgatagcggcacattttcttgggaaattgctccggttgaaatttcttccggt
agagggaaaccaccacttattgttgacaaggatgagagtcttgcaaagttcaattcagcg
aagctgaggaaacttgggccgactttcaagaagaatggttctgtaactgccggcaattct
tctagtataagtgatggtgctgctgcaatcgtgctagtcagtggacagaaagccaagagt
cttggccttcaagttattgcaaggatcagagggtatgcggatgctgctcaggcacctgaa
ttatttacaactactccagctcttgctattccaaaggctgtatcaaatgcgggtctccaa
acttcacaaatagattattatgagataaacgaagctttctccgtcgttgctttagccaac
cagaagcttcttggtattccttcgggaaagcttaacctaagtggtggtggtgtttctctg
ggccatcctattggttgcagtggtgcgagaatcatagtcactttgctcgggattcttaga
cataaaaatggaaagattggggttgctggagtttgcaatggaggtggtggtgcttctgcc
cttgttgtggaactcatgcaaccatcactatttacacgttcctcgttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346520
Entry
4346520           CDS       T01015                                 
Name
(RefSeq) acetyl-CoA acetyltransferase, cytosolic 1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00380  Tryptophan metabolism
osa00620  Pyruvate metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa00650  Butanoate metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
Module
osa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4346520
   00630 Glyoxylate and dicarboxylate metabolism
    4346520
   00650 Butanoate metabolism
    4346520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4346520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4346520
   00310 Lysine degradation
    4346520
   00380 Tryptophan metabolism
    4346520
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4346520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4346520
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     4346520
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4346520
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-GeneID: 4346520
NCBI-ProteinID: XP_015651167
UniProt: Q6K3Z3 A0A8J8XIK0
LinkDB
Position
9:3970057..3975735
AA seq 401 aa
MASDNIGSRDVCVVGVARTPMGGFLGALSSLSATKLGSIAIEAALKRANVDPALVQEVFF
GNVLSANLGQAPARQAALGAGIPNTVVCSAVNKVCASGMKATMFAAQSILLGINDIVVAG
GMESMSNAPKYIAEARKGSRFGHDTLVDGMLKDGLWDVYGDFAMGNCAELCADNHALTRE
DQDAYAIQSNERGIAARNSGAFAWEIVPIEVPVGRGKPPVLVDKDEGLDKFDPVKLKKLR
PSFKENGGTVTAGNASSISDGAAALVLVSGQKAQELGLQVIARIKGFADAAQAPELFTTS
PALAIPKALANAGLESSRVDYYEINEAFSAVALANQKLLGIPSEKINVHGGAVSLGHPLG
CSGARILVTLLGVLREKGGKIGVAGVCNGGGGASALVLELA
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggcttcggacaacattggctcgagagatgtatgtgttgttggggttgcacgcacccct
atgggtggtttcctaggtgccctgtcttccttgtcagctaccaaacttggttccatagca
attgaagctgctctgaagagggcaaatgttgatccagcccttgtgcaagaggtcttcttt
ggtaatgtgttgagtgctaatttggggcaagctcctgcaagacaagctgctttaggtgca
gggataccaaacacagttgtttgcagcgcagttaacaaagtttgcgcatctggcatgaaa
gcgacaatgtttgcagcacagtcaattctattgggcatcaatgatattgttgtagccggt
ggcatggaaagcatgtctaatgctccaaaatacattgctgaagctagaaaaggatctcgt
tttggacatgacactcttgttgatggcatgcttaaagatggcctttgggatgtatacggt
gattttgccatgggaaattgtgctgagctttgtgctgacaatcatgctctgacaagggaa
gaccaggatgcctatgctattcaaagcaatgagcgtggaattgctgctcggaacagtggt
gcttttgcatgggagattgttccgattgaagttcctgttgggagagggaaaccaccggta
cttgttgacaaagatgagggcctggacaagtttgacccagtgaaactgaagaagctccgt
cctagtttcaaggagaatggtggtactgttactgctgggaatgcttctagtataagtgac
ggtgctgccgcattagtattggtgagtgggcagaaggcacaagaacttggactgcaagtt
attgcacgaatcaaaggatttgcagatgcagctcaagctcctgaattatttaccactagc
ccggcacttgccatacctaaggctcttgctaatgctggcttggagtcttctcgtgttgat
tactatgaaattaatgaagccttttcagctgttgcacttgcaaatcaaaagcttcttgga
attccttcagaaaaaattaatgtacatggaggagctgtgtctttaggacatcctcttgga
tgcagtggtgctcgaattttggtcaccctgcttggtgttcttagggagaaaggtggcaaa
atcggagttgctggtgtttgcaatggcggaggcggagcatctgctctcgttctcgagctt
gcataa

DBGET integrated database retrieval system