KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326152
Entry
4326152           CDS       T01015                                 
Name
(RefSeq) RING-box protein 1a
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4326152
   04120 Ubiquitin mediated proteolysis
    4326152
  09124 Replication and repair
   03420 Nucleotide excision repair
    4326152
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4326152
   03400 DNA repair and recombination proteins [BR:osa03400]
    4326152
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     4326152
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   4326152
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     4326152
   Cul2 complex
     4326152
   Cul3 complex
     4326152
   Cul4 complex
     4326152
   Cul7 complex
     4326152
   Cul9 complex
     4326152
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      4326152
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      4326152
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3 zf-RING_UBOX zf-RING_16
Other DBs
NCBI-GeneID: 4326152
NCBI-ProteinID: XP_015618780
UniProt: Q0JRD5 A0A0P0UX93
LinkDB
Position
1:371836..374448
AA seq 126 aa
MSAMETDINAPPPPAPAPAGAGEGSSSAAGPSSRKPNKRFEIKKWNAVALWAWDIVVDNC
AICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWE
FQKYGH
NT seq 381 nt   +upstreamnt  +downstreamnt
atgtcggccatggagaccgacatcaacgcgccgccgccccccgcccccgcccccgccggc
gccggcgagggatcctcctctgccgccggcccctcctcccgcaagcccaacaagcgcttc
gagatcaagaagtggaacgccgtcgcgctctgggcatgggatatcgtcgtcgacaactgc
gccatctgccgcaaccacatcatggatctatgcatcgagtgccaggcgaaccaggccagc
gccaccagtgaggagtgcactgtcgcttggggtgtctgtaatcatgcttttcacttccat
tgcatcagcaggtggctcaagactcgccaagtgtgcccgttagataacagtgaatgggaa
tttcagaaatatgggcactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330476
Entry
4330476           CDS       T01015                                 
Name
(RefSeq) RING-box protein 1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04120  Ubiquitin mediated proteolysis
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4330476
   04120 Ubiquitin mediated proteolysis
    4330476
  09124 Replication and repair
   03420 Nucleotide excision repair
    4330476
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4330476
   03400 DNA repair and recombination proteins [BR:osa03400]
    4330476
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     4330476
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   4330476
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     4330476
   Cul2 complex
     4330476
   Cul3 complex
     4330476
   Cul4 complex
     4330476
   Cul7 complex
     4330476
   Cul9 complex
     4330476
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      4330476
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      4330476
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3 zf-RING_UBOX
Other DBs
NCBI-GeneID: 4330476
NCBI-ProteinID: XP_015625781
UniProt: Q8S3S0 Q6YV20
LinkDB
Position
2:29284969..29287554
AA seq 114 aa
MDKGDVAVAVPPSIAGASSSGAKKGKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDLCI
ECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH
NT seq 345 nt   +upstreamnt  +downstreamnt
atggacaagggcgacgtcgccgtggccgtgcccccctccatcgccggcgcctcctcctcc
ggggccaagaagggcaagcgcttcgagatcaagaagtggaacgctgtctccctctgggcc
tgggacatcgtcgtggacaactgcgccatctgccgcaaccacatcatggacctctgcatc
gagtgccaggcgaaccaggcgagcgccaccagcgaggagtgcaccgtcgcttggggagtt
tgcaaccatgcattccacttccactgcatcagccgttggctcaagacccgtcaagtgtgc
cctctagacaacagcgagtgggagttccagaagtatggtcactag

DBGET integrated database retrieval system