KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326190
Entry
4326190           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 40 isoform X1
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4326190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4326190
   03009 Ribosome biogenesis [BR:osa03009]
    4326190
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4326190
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    4326190
 Complex B
    4326190
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    4326190
SSDB
Motif
Pfam: DEAD Helicase_C ResIII WW ERCC3_RAD25_C
Other DBs
NCBI-GeneID: 4326190
NCBI-ProteinID: XP_015620980
UniProt: Q5JKF2
LinkDB
Position
1:20522447..20528198
AA seq 792 aa
MSAGTAPAAPRYAPDDPSLPKPWRGLVDGTTGYLYYWNPETNITQYEKPLPPEDQLPPPP
PLPPPPPRSGRGDRDRDRRDRSRSRTPPRRDHRDRDRDRDRRHDDHRSAPSHHHPLPAAA
AIAADDPSTEAYRHRHEITVVGDNVPAPITSFETGGFPPEILKEIQRAGFSSPTPIQAQS
WPIALQCQDVVAIAKTGSGKTLGYLLPGFMHIKRLQNNPRSGPTVLVLAPTRELATQILE
EAVKFGRSSRISSTCLYGGAPKGPQLRDLDRGVDVVVATPGRLNDILEMRRISLKQVSYL
VLDEADRMLDMGFEPQIRKIVKEIPPRRQTLMYTATWPKEVRRIAEDLLVHPVQVTIGSV
DELVANSAITQNVELITPSEKLRRLEQILRSQDSGSKVLIFCTTKRMCDQLARTLTRQFG
ASAIHGDKSQSEREKVLSHFRSGRSPILVATDVAARGLDIKDIRVVINYDFPTGIEDYVH
RIGRTGRAGATGVAYTFFCDQDSKYAADLIKILEGANQRVPRDLADMASRGGRGGRKRNR
WATRSDRGGSHSELDSRYGGRDGLSGSSGRLDSSRSSRRHDYGDDGRSRRSGRGRSRSRS
RSDSDRYSRSPKRSRRHSRSRTRSRSRSRSRSYTRNRRASRSRSRSPGASRRHERSATGS
GSALPDSGHGERKRTPEADPSRNHTNHSDPKDDRHPEDGKVGKVDLDRSPTPQDKSGPYS
PAYNGKTSRSVSPGNQVEGNNKAAEVSKNPDPSSPPHHGKTREDEEEGMIDEDGEIADDP
RANATVQNGGDN
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgtcggcagggaccgccccggccgcgccgcggtacgcgccggacgacccgtcgctcccc
aagccgtggcgcgggctcgtcgacggcaccaccggctacctctactactggaacccggag
accaacatcacccagtacgagaagccgctgccgcccgaggaccagctcccgccgcccccg
ccgctccccccgccgcctccccgctccggccgaggcgaccgagaccgcgaccgccgcgac
cgctcccgatcccgcaccccgccgcggcgcgaccaccgggaccgcgaccgggaccgcgac
aggcgccacgacgaccacaggtcggcgccttcccaccaccatcctcttccggccgccgcc
gccatcgccgccgatgatccctccaccgaggcgtatcgccaccgccacgagatcaccgtt
gtcggggacaacgtgccagctccgataacttcgtttgagactggtggattcccaccggaa
atcctcaaggagatacaacgtgctggattctcaagtccaacgccaatccaagctcagtca
tggccaattgccttgcagtgtcaagatgttgtagctattgcaaagacaggatctggaaaa
actcttgggtatctacttcctggatttatgcatattaaacgcttgcaaaacaacccaagg
tctggtccaacagtgctagttttggcaccgacaagggagcttgcaactcagattttggaa
gaagctgtgaaatttggcagatcatcaagaatttcttccacgtgtctatatggtggtgct
ccaaaaggcccccagctaagagatttggatagaggggtcgatgtcgttgttgctacacca
ggaaggttgaatgacatcctagaaatgcgaaggataagccttaagcaagtgtcgtacctt
gttctagatgaagctgaccgtatgttggacatgggatttgaaccacaaattcggaagata
gtgaaagaaattcctcctcgtcggcaaaccctcatgtacactgctacttggcctaaggaa
gtccgacgaattgcagaggatcttcttgttcaccctgtccaggtgaccattggaagtgtt
gatgagcttgttgctaatagtgctattactcagaatgtggagctgatcacaccgtccgaa
aagcttcgccgtctggagcaaattttgcgatcccaggattcaggttcgaaggtactaata
ttctgtaccactaagagaatgtgcgaccaacttgcaaggacacttactaggcaatttgga
gcttctgccattcatggtgataagtcccaaagtgaaagagagaaggtcctgagccatttt
agatctgggcgatctcctattttggttgcaacagatgttgctgcacgaggcttagacatc
aaagatatcagggttgtgatcaattatgatttccccactggcattgaagattatgttcac
cggattggcaggactggaagggctggtgccactggtgtggcctatacgtttttctgtgac
caggattcaaaatatgctgctgatcttattaaaattctggaaggcgcaaaccaacgtgtg
cctcgtgacttggcggacatggcctctcggggtgggcgtggtggtaggaagcgtaaccgg
tgggcaacccgctctgataggggtggttcgcattctgaactggattctaggtatggtgga
agagatggtctgtcagggtcttctggcagattggatagtagtcgcagtagtcgcaggcat
gactatggtgatgatggacggtctcgcaggtctgggagaggtcgcagtaggagccgtagc
agaagtgacagtgataggtatagccgaagtcctaagaggtcacgccgtcatagccgtagc
aggaccaggagtcggagccgaagcaggagcaggagctacactaggaaccgtcgtgctagc
cgcagcaggagccgtagccctggtgctagccgtaggcatgaaagaagcgctactggctct
gggtctgcactgccagactctgggcacggtgagcgcaaaagaacaccagaagctgaccca
tcaagaaaccatacaaaccactcagacccgaaagatgaccgacacccagaggatgggaag
gtgggaaaggttgatctcgatcggtcgcctactccacaagacaagtctggcccatatagt
cctgcttacaatggaaaaaccagtcgctcagtgagccctggtaatcaggtggaaggaaac
aacaaagctgcggaggtttctaagaatcctgatccttcatcgccaccccatcatggtaag
accagggaggacgaagaggaaggtatgatagatgaagatggagagatagctgatgatcct
cgggcaaatgcaaccgtgcagaatggcggtgataattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327645
Entry
4327645           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 14 isoform X2
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4327645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4327645
   03009 Ribosome biogenesis [BR:osa03009]
    4327645
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4327645
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    4327645
 Complex B
    4327645
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    4327645
SSDB
Motif
Pfam: DEAD Helicase_C ResIII WW ERCC3_RAD25_C SWI2_SNF2 SNF2-rel_dom PepSY_TM IKI3
Other DBs
NCBI-GeneID: 4327645
NCBI-ProteinID: XP_015621421
UniProt: Q5VQL1 B9ET41 A0A8J8Y3D2
LinkDB
Position
1:complement(3713724..3718632)
AA seq 708 aa
MASAAAAAATARGPRYAPPDPTLPKPWRGLIDGNTGYLYFWNPETKAVQYDRPTAPPPSS
PPAQQPPERPRNSDPAESQAQAGASRTQNAAPADDRARNDHLNDHFERRTEAAGSHAQNV
PFTEQNTRSNPSSQPCSAAGVYPAQNVFSEAASGDRTSPEAYRAKHEITIVGNEAPAPFM
TFQSTGFPPEILREVQQAGFSAPTPIQAQSWPIALRNRDIVAVAKTGSGKTLGYLIPGFI
LLKRLQHNSRDGPTVLVLSPTRELATQIQDEAKKFGRSSRISSVCLYGGAPKGPQLRDLE
RGADIVVATPGRLNDILEMRRVSLHQVSYLVLDEADRMLDMGFEPQIRKIVKQVQPKRQT
LMFTATWPKEVRKIASDLLSNPVQVNIGNTDQLVANKSITQYVDVITPPEKSRRLDQILR
SQEPGSKIIIFCSTKRMCDQLARNLARQYGASAIHGDKSQAERDSVLSEFRSGRCPILVA
TDVAARGLDIKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGVAYTFFCDQDSKYASDLV
KILEGANQSVSQQLRDMVSRGGYGGRSRRWASSDDSYGGRGYDSGYTSRSTDNYNSGYGS
QSGNGSSFHSSFHNSNSGNQFGDTSGFQTSFHNSSSNNQTSDNPSFHASSNNDQPGDGLS
FHARFYSSSRGSDQSRTNNAGFRDRSRSPPSNRNHEDPGSKAVGVSNW
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggcgtcggcggcggcggcggcggcgacggcgagggggccgcggtacgcgccgccagat
ccgacgctgcccaagccgtggagggggctcatcgacggcaacaccgggtacctctacttc
tggaacccggagaccaaggccgtgcagtacgaccgccccacggcgccgccgccctcctcc
cccccggcgcagcagcctccggagaggcctaggaacagcgatcctgctgagtcgcaggcg
caggctggagcgagccgaacgcagaatgctgctcctgctgatgatagggcaaggaatgat
catttgaatgatcatttcgagcggcgcacggaagcggcgggaagtcatgcgcagaacgtg
cctttcactgagcaaaatactaggagcaacccttcttcgcagccgtgctctgcagctgga
gtataccctgcacagaatgtattttcagaggctgccagtggagaccgcacctcaccagaa
gcgtatcgtgctaagcacgagatcactattgtcggaaatgaggctccagctccattcatg
acatttcagtccacaggtttccctccagagattctaagggaggtacagcaagcgggattc
tctgcaccaactcctatccaagctcaatcatggccaattgctcttaggaatcgtgatatt
gtagctgtggcgaagacaggttccggaaaaacactgggttatctcattccagggtttatc
cttcttaagcgccttcaacataattcaagggatggtccaacggtattagtgctttctcca
acaagggaattggcaacacaaatccaagatgaagcgaaaaagtttgggagatcgtcaaga
atatcgtctgtttgtttatatggaggtgctcctaaaggtcctcagctaagagatctagag
cgtggtgcagacattgtggttgcaactcctggaagattgaatgacattttagaaatgcga
agagtgagcctacatcaagtatcttatcttgttcttgatgaggctgaccgcatgcttgat
atgggttttgagccacaaataagaaaaattgtgaaacaagtacaacccaaacgacagact
cttatgttcactgccacttggccaaaagaggtgaggaaaatagcctcagatttgctgtcc
aatccagtccaagttaacattgggaacactgatcaactggttgccaataagtcaatcact
cagtatgtggatgttatcacacctccggagaaatcgaggcggcttgatcaaatcctaagg
tcacaggaacctggatcgaaaatcataatattttgctccacaaagaggatgtgtgatcag
ctggctcgaaacctagcacggcagtatggtgcttctgctattcatggtgataaatcacaa
gccgagagggattctgtgttgagtgaatttcgaagtggcagatgccctattcttgttgct
actgatgtggctgcccgaggcttggacataaaggatatcagagttgtggtcaactacgat
ttcccaacaggtgttgaggattacgtccatagaattgggagaacaggacgggctggagcg
actggagttgcctatacattcttctgtgatcaggattcaaagtatgcttcagatctcgtg
aagattttggagggtgcaaaccagtctgtttcgcaacagttgagagatatggtctcccgt
ggagggtatggtggaaggtcacggcgctgggcatcttcagatgactcttatggtggtcga
ggatatgattcaggctatacttcaaggtcgactgacaactataacagtggttatggcagt
cagtctgggaatggttctagctttcatagtagcttccataacagcaacagtggcaatcag
tttggcgatacttctggcttccaaaccagctttcataacagcagcagcaacaatcaaacc
agtgacaatccaagctttcatgccagcagcaacaacgatcaacctggtgatggtctcagc
tttcatgccaggttctatagctcttctcgaggcagcgatcagagcagaacaaacaatgct
ggctttcgtgatagaagtaggagtcctccaagcaatcgcaaccatgaagatcctgggtcc
aaggctgttggtgtctccaactggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351155
Entry
4351155           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 40 isoform X1
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4351155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4351155
   03009 Ribosome biogenesis [BR:osa03009]
    4351155
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4351155
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    4351155
 Complex B
    4351155
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    4351155
SSDB
Motif
Pfam: DEAD Helicase_C ResIII ERCC3_RAD25_C WW AAA_22
Other DBs
NCBI-GeneID: 4351155
NCBI-ProteinID: XP_015617272
UniProt: Q2QZE8 A0A5S6R6Q9
LinkDB
Position
11:27997550..28005151
AA seq 1398 aa
MAATEAATDSSGPRYAPDDPTLPAPWKGLIDGSTLYYWNPDTNETQYERPVAAVPPLPTG
PPPVTTTPMPTSASGAFSQPSMQSNQGGQVSQSQQERPGQTVYPQASHLGHQQLQQPTQQ
SPFQPTAQHQAPFQHSQRAPYQQQQQQMSQQPPAHQYPSTHPQHMPYQHGHYMQPQQQQF
QQGPQYSYQVGQQQQMPQAAYNQGQQQPISQAAYNQSQQPAQAVGAYNQGQQPPVSQASY
NQSQQPTQAAGAYNQGQQPSMPQASYNQVQPPQMAHATYNQGQQPPGMRIPQGQVQPQQS
PGFHQPAQVSQVLQGSQSQGLQMPPQQGQLQHGFHLTTPQGKQPHHGHVGPQLSQVPLGQ
QSSTLKVDETGVTGGLDGKQTGFSLPLSQQRGQGPVSKQQLPSNHQLSGSHNQPNIPGAG
GPSYPAKHHLGGSSPGEANNMNFLSSPAQMHQGGMDTNYRQHPASSPVVPNHIGPSPVRP
PMGFKMGSSEDHFERNELYSSGRMDGTNNLQQQPKLAALPPLNRPQDMRNGPPYPQPDNL
GAFNMGPPHSVPNLHNHGPFPEASMRPPSRMFAPPNFPSIASADAYRQHHEVTAVGENVP
PPFMTFEATGFPPEILQEIHAAGFLNPTPIQAQTWPVALQNRDIVAIAKTGSGKTLGYLI
PAFIHLRRYQNNPMLGPTVLVLAPTRELASQIQDEAVKFGRSSRVSCTCLYGGTSKGLQL
RELERGADIVVATPGRLNDILEMRKISLHQVSFLVLDEADRMLDMGFEPQIRKIVDEIPR
NRQTLMYTATWPKEVTKIAGDLLKDPVQVNIGSIDELVANKSITQYVEVVPPLDKQRRLE
QILRAQERGSKVIIFCSTKKMCDQLARDIGRSFGAASIHGDKSQAERDNVLNQFRTGRAP
ILVATDVAARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGATGVSYTFFSEQDWKYA
GDLVKVLEGANQHVPPELQEMAARGAAGAPRNQAGGMSRWDGPGGGGNRFESAVGIPGSY
GGIRDGPGGFGGRDGPGGFGGRDGPGGFGGRDGPGGFIGREGPGGFGGREGPVGFGGQES
PGGFGGRKGPGAFEGREGAAPGSFGGRGGRGPGGFGGRGGGSPGGFGGRGGRGDSHGFGG
RGRGDFSGFGGRGRGDSSGFGGRGRGDFSGGRGGRGRGFGGRGRSDRGPHDRFISDGRGR
YDNRRGFGGKGRDRSYSRSPDRGRSRGYDRRSGSRSLSSRSRSRSRSWSRSRSRSRSWSR
SRSRSRSPSRSRSRSYDQGAGPARRPRPRSGFDVLPPATGAGPASTGPGPVAVPAPGSAG
PVPPQVPAQSLADASAMSPMSPGGLAQEGAPFNGGNDGGLVPAQGVLPFQGSDVAMPPNF
AAAEAFPGPAVEQEAPDV
NT seq 4197 nt   +upstreamnt  +downstreamnt
atggcagctacagaggccgccacagattcatcgggtccgcgatatgctcctgatgaccca
acgctccctgcaccctggaaaggactaatcgatggatcaaccttgtactactggaaccct
gatactaatgagactcaatatgagaggccggtggccgctgtgcctcccttgccaacaggt
cctcctccagtaaccactacacctatgccaacatccgcatcaggggctttttcacagcct
agcatgcagtcgaaccaaggtggtcaagtatcacagtcccagcaggaacgacctggtcag
acagtataccctcaagccagccatcttgggcatcagcaactccaacagccaacccagcaa
tcaccgtttcagccaacggctcagcatcaagctccgtttcagcattcacaacgagcgccc
tatcaacaacagcagcagcagatgtcgcagcaacctcctgcccatcagtaccccagcaca
catccacaacatatgccataccagcatggccattatatgcaaccccagcagcagcagttt
cagcagggcccacaatattcatatcaggttggccagcagcaacagatgccgcaagctgcc
tacaatcaaggtcagcagcagcctatttctcaagctgcctacaaccaaagtcagcagcca
gcgcaagccgtgggtgcctacaatcaaggtcagcagccgcctgtttctcaagcctcatac
aaccaaagtcagcagccaacacaagctgcaggtgcctacaatcaaggccagcagccgtca
atgccccaagcttcctataatcaagttcagccgccacaaatggcacatgctacttacaat
caaggtcagcagccacctggaatgaggatccctcagggtcaggtgcaacctcagcaatca
ccgggctttcatcaacccgctcaggtttcacaagtgctgcaaggttcacagtctcaagga
cttcaaatgccgccacagcaaggccaactccagcatggcttccatttgacaactcctcag
ggaaaacaaccacatcatggccatgtaggtcctcaattgagccaagtgccacttgggcag
cagagttccactctgaaggttgacgagacaggagttacaggaggtcttgatggaaaacag
actggtttttcattaccactcagtcagcagcgtggccagggtcctgtttcaaaacaacag
ttaccttctaatcatcaactttctggatcacataatcagccaaatattcctggagctgga
gggccatcatatcctgcaaagcatcatcttggtggatcatccccaggcgaggctaacaac
atgaattttttgagctcacctgctcaaatgcatcaaggtggtatggatacaaactatcga
caacatccagctagcagtcctgtcgttccaaatcatattggtccttcaccagttcggcct
ccaatgggtttcaagatgggcagtagtgaggatcactttgaaagaaatgagctttactct
tctggcaggatggatggaacaaataatctccagcagcagccaaagcttgctgcactacca
ccactaaaccggccgcaggatatgaggaacgggccgccttatcctcagccagataattta
ggggcttttaacatgggacctccacattcagtgccaaatttgcataaccatggtccgttt
cctgaagcttcaatgaggcctccgtccagaatgtttgctcccccaaattttccgagcatt
gcttcagctgacgcatatcgtcaacaccatgaagtcactgcagtgggtgagaatgtgcct
cctccatttatgacattcgaggctactggattccctccagagatcttgcaagagatccat
gcagctggcttcttaaaccccactccaattcaagctcaaacatggcctgttgcactgcaa
aatcgggacatagtagctattgccaagacaggatcagggaagacgctggggtaccttatt
cctgcttttatacatcttaggcgataccaaaacaacccaatgttgggccctacagtgtta
gttttggcccctacccgagagcttgcttcacaaatacaagacgaagcagtcaagtttggt
cgatcatctagagtctcctgcacttgtctgtatggggggacttcaaagggccttcagcta
agagaacttgagcgtggagcagatattgtcgttgcaactcctggacgtcttaatgatatc
ctggagatgaggaagattagtctccatcaagtttcatttcttgtgcttgatgaggctgac
cgtatgcttgatatgggttttgagccacaaatacgtaagattgtggatgagattcctcga
aacagacagactctgatgtatacggccacttggccaaaggaagttacaaaaattgctggg
gatttactgaaagatcctgttcaggttaatattggtagcattgatgaactcgttgccaac
aaatccatcacacagtatgtagaggtggttccaccattggacaagcagcggcgattggag
cagatacttagagctcaagaaaggggctctaaggtcatcatattctgctcaaccaagaaa
atgtgtgaccagcttgctcgtgacattggtcgtagttttggtgctgcaagtattcatggt
gataaatcacaggctgaaagggataatgttctgaatcagtttcgcactggcagagctcca
atattagtagccacagatgttgctgctcgtgggcttgacatcaaagatatcagagtagtg
atcaattatgactttcccactgggatcgaggactatgttcaccgtatagggcgtacagga
agggctggggcaactggagtctcatatactttcttttctgaacaagattggaaatatgct
ggtgatttggtgaaagtcttggaaggtgctaatcagcatgtccctccagagttgcaagag
atggctgcaagaggtgcagctggagctccaagaaatcaagctggtgggatgagccgttgg
gatggacctggtggtggtggtaaccgttttgaatctgctgttggtattcctggtagttat
ggtggaattagggatggcccaggcggctttggtggccgtgatggcccaggcggttttggt
ggacgggatggcccaggcggctttggtggtcgggatggccctgggggttttattggtcga
gaaggtcctggtggctttggcggtcgggagggtcctgttggctttggtggtcaggagagt
cctggtggctttggtggacgcaagggacctggtgcctttgaaggtcgagagggtgctgct
cctggtagctttggtgggagaggtggtcgtggacctggtggttttggtggcagaggtgga
ggaagtcctggtggttttggtggccgtggtggcaggggtgattctcatggttttggtgga
cgtgggaggggtgacttttctggctttggtggacgtggcaggggtgattcttctggcttt
ggtggacgaggccgtggtgatttctctggtggacgtggtgggagagggcgtggatttgga
gggcgtggacgatctgaccgaggcccacatgaccgttttatctcagatggacgtggaaga
tacgataaccgccgaggatttggtggcaagggtcgggaccggagctacagccgcagccca
gatagaggccgctcgcgaggctatgaccgaagaagtggcagtaggagcctaagtagtagg
agcagaagccgaagcaggagctggtcacgtagtaggagccgcagcaggagctggagccgg
agccgtagccgcagccgcagcccaagtcgcagcaggagcagaagctatgaccagggtgca
ggaccggcacgcaggccccggcctagatccggcttcgatgtcctgccacctgcaaccgga
gccggtcctgcttcaaccggtcctgggcctgtagctgtacctgcacctggatcagcaggt
cctgttcccccgcaggtacctgcacaatcactggctgatgcatctgcaatgtcaccaatg
tcaccaggtggcctagcacaagaaggtgcaccgttcaacggcgggaacgatggcggcctc
gtcccagcacaaggggtactccctttccagggttctgatgtagcaatgccaccaaatttt
gctgcagctgaagcgtttccaggcccggcagttgagcaggaagcccctgatgtataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268869
Entry
9268869           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 20
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9268869
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    9268869
   03009 Ribosome biogenesis [BR:osa03009]
    9268869
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9268869
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    9268869
 Complex B
    9268869
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    9268869
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 9268869
NCBI-ProteinID: XP_015611419
UniProt: Q5QMN3
LinkDB
Position
1:complement(5243038..5251192)
AA seq 494 aa
MSRFDGRAADPGSYRDRRSEGAFGGGTRAFAPTSKADSAAAAADLDGLPRFEKNFYVESP
SVAGMTEEEVEAYRRRREITVEGRDVPKPVREFRDVGFPEYVLQEITKAGFVEPTPIQSQ
GWPMALRGRDLIGIAETGSGKTLAYLLPAIVHVNAQPILAPGDGPIVLVLAPTRELAVQI
QQEATKFGASSKIKSTCIYGGVPKGPQVRDLQKGVEIVIATPGRLIDMIESHHTNLRRVT
YLVLDEADRMLDMGFEPQIKKIVSQIRPDRQTLYWSATWPKEVEQLARNFLFDPYKVIIG
SEELKANHAISQHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDG
WPALSIHGDKSQAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDY
VHRIGRTGRAGAKGTAYTFFTAANARFAKDLINILEEAGQKVSPELANMGRGAPPPSSGH
RDRYRGYGGGRSWS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgagccgcttcgacggccgcgccgcggaccccggctcgtaccgcgaccgccgcagcgaa
ggggcgttcgggggcgggacgagggcgttcgccccgacgagcaaggcggactccgcggcc
gcggccgctgacctggatgggctgccgcggttcgagaagaacttctacgtggagtccccc
tccgtggccggcatgacggaggaggaggtggaggcctaccggcgccgccgggagatcacc
gtggagggccgcgacgtgcccaagccagtgcgcgagttccgcgatgtcggattcccagaa
tatgttttgcaagaaattacaaaagctgggtttgtagaacctactcctatccagtctcaa
ggttggccaatggcactgaggggacgtgatcttattggcattgctgaaacaggatcaggg
aaaacacttgcttaccttttacctgccattgttcatgttaatgctcagccgattctagca
cctggcgatggtccaattgttctggtgttagcccctacacgtgaacttgctgtgcagata
cagcaagaggcaactaagtttggtgcgtcatcaaaaataaaaagtacttgcatatatggt
ggtgttccaaaaggtcctcaagttcgcgatcttcaaaaaggcgttgaaattgttatagcc
acgccaggaagactgattgatatgatagaatcacatcatacaaatttgcggagggtcact
taccttgttttagatgaggcagaccggatgctggatatgggctttgaacctcagattaag
aaaattgtttctcagattcgtccagatcgccaaacattatattggagtgctacttggcca
aaggaagttgaacagctagcaaggaactttcttttcgacccatacaaggtcataattggt
tctgaggagttgaaagctaatcatgccatttctcaacatgtggagatattatccgagagt
cagaagtacaataagttggttaatctactggaggatataatggatggcagccggatatta
atatttatggacacgaagaagggatgtgatcaaatcactagacagcttcggatggatggt
tggcctgctctgtctatccatggtgacaaaagccaagctgagagggattgggttctttct
gaatttaaatcagggaaaagccctatcatgacagcgactgatgtggctgctcgaggctta
gatgttaaggatgttaaatatgtcattaactatgactttccgggatcattggaggattat
gttcatcgcattggtcgaactggcagagctggagcaaaaggaacagcttacacgtttttc
actgctgctaatgccagatttgccaaggatctgatcaacatactagaagaagctggacaa
aaggtcagccctgaattagctaatatgggtcgtggtgcaccacccccttcttcaggccac
cgtgatagatatagagggtatggaggtggccggtcatggagctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271802
Entry
9271802           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 30
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9271802
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    9271802
   03009 Ribosome biogenesis [BR:osa03009]
    9271802
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9271802
Spliceosome [BR:osa03041]
 Complex A
  U1 snRNP components
   U1 related factors
    9271802
 Complex B
    9271802
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    9271802
SSDB
Motif
Pfam: DEAD Helicase_C AAA_30 ResIII
Other DBs
NCBI-GeneID: 9271802
NCBI-ProteinID: XP_015648572
UniProt: Q5N7W4
LinkDB
Position
1:complement(39688289..39692729)
AA seq 666 aa
MRTSRVASPPPSPKDHDTWAIATDLARPHTLRILTHQNQTTGLLTPPHAAFLPDPNLPRR
LPFPSSSSTPTAAAPPDSGEPSRARARTETYRTGDMNPYDLRYADPSSYRDRRSDLAGAP
VLAASAPAAANPYAAAYAPAPAAPVAPAGGDFSRFGGRGRGGGAGGGGWGRGGGGGGGAG
GYRGGGGRGGGRDALDSLSLPKPDFRSLIPFEKNFYVECPAVQAMSDMDVSQYRRQRDIT
VEGHDVPKPVRYFQEANFPDYCMQAIAKSGFVEPTPIQSQGWPMALKGRDMIGIAQTGSG
KTLSYLLPGLVHVGAQPRLEQGDGPIVLILAPTRELAVQIQQESGKFGSYSRTRSTCIYG
GAPKGPQIRDLRRGVEIVIATPGRLIDMLEGGHTNLRRVTYLVLDEADRMLDMGFEPQIR
KIVAQIRPDRQTLYWSATWPREVESLARQFLQNPYKVIIGSPDLKANHSIQQIIEVISEH
EKYPRLSKLLSDLMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKAQAERDYVLA
EFKSGKSPIMAATDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAGASGTAFTFF
TLSNAKFSRNLVKILREAGQVVNPALESMAKSASSMGGGNFRSRGRGGFGNRSGSNSIPI
RGRRPY
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgcgtacgagccgcgtcgcgtctccccccccctcccccaaggaccatgacacgtgggcc
atagcaaccgacctagcccggccccacacgcttcgcatccttacccatcaaaaccaaacc
acgggcctcctcaccccgccgcacgccgccttcctcccagatccaaacctccctcgtcgt
ctccccttcccctcctcctcctcgacccccacggcggcggcgccaccggactccggcgaa
ccctcgcgcgcgcgcgcacgcaccgagacgtaccgtaccggcgacatgaatccctacgac
ctccgctacgccgacccttcctcctaccgcgacaggcgcagcgaccttgccggggctccc
gtgctcgccgcgtcggcccccgcggccgccaacccctacgccgccgcgtacgcgcccgcg
ccggctgctcccgtggcccccgctggtggcgacttctcgcgcttcggcgggagaggccgt
ggtggaggcgcgggcggcggtgggtggggtagaggtggtggtggtggtggtggcgctggc
ggataccgaggcggcggtgggagaggaggtggaagggacgcgctggactcgctctccttg
ccgaagcctgacttccggagccttatacccttcgagaagaacttctatgtggagtgcccc
gccgtgcaggccatgtcagacatggatgtgtcgcagtatcgtcgccagcgtgatatcact
gttgaaggccacgacgtgcccaagccggttcgctacttccaggaggccaacttcccagat
tactgtatgcaagcaatagccaagagtggattcgtagagcccacgcctattcagtcacaa
ggttggccaatggctttgaagggcagggacatgatcggtatcgcacaaactggctctggg
aaaacactatcttaccttctccctgggttggttcatgttggtgcacagcctcgactagaa
caaggtgatggcccaattgttctgatccttgctcctacaagagaactggctgttcaaata
caacaagaatctggcaaatttggatcatactcaagaactagaagcacttgtatctatggt
ggagcacctaagggaccacaaatacgtgaccttaggagaggggttgagattgtcattgca
acacctggtcggttgatcgatatgctggaaggtggtcacactaacctgcgaagagtaaca
tacctcgtcctggatgaggctgaccgcatgcttgacatgggttttgagccccagattcgt
aaaatagtggcacagatccggccagacaggcaaaccttgtattggagtgccacttggcca
agagaagtagaatccttggctagacaatttctgcagaacccatacaaggtaatcatagga
tcacctgatctgaaagctaatcattccatacagcaaattattgaggtcatatctgaacac
gaaaagtatcccagactcagtaaacttttatctgatctaatggatggaagcagaatcttg
atatttttccaaactaaaaaggactgtgacaaggtcactcgtcaacttagaatggatgga
tggccagcattatctattcatggtgacaaagctcaagcagaaagggactatgttctggca
gagttcaagagtgggaaaagtcctataatggctgccacagatgtagcggcacgtggtctt
gatgtcaaggatattaagtgtgtgataaattttgattttccaacaactcttgaagattat
attcacagaataggtcgaactggccgcgctggtgctagtggaactgcattcacctttttc
acactctccaatgcaaaattctccaggaatcttgttaagatcttgagggaagctggccag
gttgtgaatccagcgctagaatctatggctaaatctgccagttctatgggaggaggcaat
ttccggtcaagggggcgtggtgggtttggtaacagatctggctcaaatagcattcccata
agaggaagaaggccatactga

DBGET integrated database retrieval system