KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326192
Entry
4326192           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 56 isoform X1
  KO
K12812  ATP-dependent RNA helicase UAP56/SUB2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4326192
  09122 Translation
   03013 Nucleocytoplasmic transport
    4326192
   03015 mRNA surveillance pathway
    4326192
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4326192
   03041 Spliceosome [BR:osa03041]
    4326192
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4326192
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4326192
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4326192
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4326192
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1 DNA_repr_REX1B
Other DBs
NCBI-GeneID: 4326192
NCBI-ProteinID: XP_015621977
UniProt: Q0JM17
LinkDB
Position
1:20540834..20547062
AA seq 432 aa
MAEAEVKDNEVYEEDLVDYEEEVENGTDGGANAANASADVVKKGYVGIHSSGFRDFLLKP
ELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQV
GALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIKKHKDLLKNDCPHIVVGTPG
RILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSKE
IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIFV
KSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDIE
RVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKEL
PEQIDTSTYMPS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggccgaagccgaggttaaggacaacgaggtttacgaggaggatctcgtcgactacgag
gaggaggtggagaacggcaccgacggtggcgccaacgccgccaacgcctccgccgatgtc
gtcaagaaggggtacgtggggatccacagctcggggttcagagacttcctgctcaagccg
gagctgcttcgcgccatccaggactgcgggtttgagcacccttccgaagtgcaacacgaa
tgcatcccacaagccattcttggaatggatgtcatctgccaagcaaaatctgggatgggg
aagactgctgtttttgttctctcaagtcttcagcaaattgatcctgttgctggtcaagtt
ggtgcacttgtgctatgtcacacaagggagctagcttaccagatttgccatgaatttgag
aggtttagcaagtaccttcctgaggtaaaagttgcggtcttctatggtggtgttcacata
aaaaaacacaaggatctgttgaagaatgactgccctcatattgtggttggaacacctgga
aggatactagctctagctagagagaaggatctttccttgaagaatgtgaggcatttcatt
cttgatgaatgtgacaagatgctcgattcacttgacatgcgtagagatgtgcaggagatc
ttcaaaatgacaccccatgataagcaagtgatgatgttttcagcgacccttagcaaggag
atccgcccagtttgcaagaaattcatgcaagatcctatggaaatttatgttgatgatgag
gctaaactgacccttcatgggctagttcagcactatattaaactaagtgaggcggagaag
aaccggaaattgaatgatctcttagatgcactggacttcaatcaagttgtgatatttgtt
aaaagtgttagtagagctgcagaactgaacaagctgctttgtgaatgcaactttcctgcg
atctccatacattctggaatgacacaggaggagaggcttacccggtacaagaacttcaag
gaaggacacaagaggattcttgtggctactgatttagttggcaggggaattgatattgaa
cgtgtcaacattgtcataaactatgacatgcccgattctgctgattcgtatctacacagg
gttggaagggctgggcgttttggaaccaaaggacttgcaataacatttgtttcctctgcc
tctgactctgatgttcttaatcaagtgcaagaaagattcgaggttgacataaaggagctt
cctgagcagattgatacttcgacatatatgccttcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326193
Entry
4326193           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 15 isoform X1
  KO
K12812  ATP-dependent RNA helicase UAP56/SUB2 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4326193
  09122 Translation
   03013 Nucleocytoplasmic transport
    4326193
   03015 mRNA surveillance pathway
    4326193
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4326193
   03041 Spliceosome [BR:osa03041]
    4326193
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4326193
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4326193
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4326193
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    4326193
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CMS1 DNA_repr_REX1B
Other DBs
NCBI-GeneID: 4326193
NCBI-ProteinID: XP_015621815
UniProt: Q5JK84
LinkDB
Position
1:20570958..20576207
AA seq 432 aa
MGEAEVKDNEVYEEDLVDYEEEVENGADGGAAAANASADVVKKGYVGIHSSGFRDFLLKP
ELLRAIQDCGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSSLQQIDPVAGQV
GALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIKKHKDLLKNDCPHIVVGTPG
RILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSKE
IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIFV
KSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDIE
RVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKEL
PEQIDTSTYMPS
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgggcgaagctgaggtcaaggacaacgaggtgtacgaggaggatctcgtcgactacgag
gaggaggtcgagaacggcgccgacggcggcgccgccgccgccaacgcctccgccgacgtc
gtcaagaaggggtacgtggggatccacagctcggggttcagagacttcctgctcaagccg
gagctgcttcgcgccatccaggactgcgggtttgagcacccttccgaagtgcaacacgaa
tgcatcccacaagccattcttggaatggatgtcatctgccaagcaaaatctgggatgggg
aagactgctgtttttgttctctcaagtcttcagcaaattgatcctgttgctggtcaagtt
ggtgcacttgtgctatgtcacacaagggagctagcttaccagatttgccatgaatttgag
aggtttagcaagtaccttcctgaggtaaaagttgctgtcttctatggtggcgttcacata
aaaaaacacaaggatctgttgaagaatgactgccctcatattgtggttggaacacctgga
aggatacttgctctagctagagaaaaggatctttccttgaagaatgtgaggcatttcatt
cttgatgaatgtgacaagatgctcgattcgcttgatatgcgtagagatgtgcaggagatc
ttcaaaatgacaccccatgataagcaagtgatgatgttttcagcgacccttagcaaggag
atccgcccagtttgcaagaaattcatgcaagatcctatggaaatttatgttgatgatgag
gctaaactgacccttcacgggcttgttcagcactatataaaactaagtgaggcggagaag
aaccggaaattgaatgatctcttagatgcacttgacttcaatcaagttgtgatatttgtt
aaaagtgttagtagagctgcagaactgaacaagctgctttgtgaatgcaactttcctgcg
atctccatacattctggaatgacacaggaggagaggctgacccggtacaagaacttcaag
gaaggacacaagaggattcttgtggctactgatttagttggcaggggaattgatattgaa
cgtgtcaacattgtcataaactatgacatgcccgattctgctgactcgtatttgcacagg
gttggaagggctggacgttttggaaccaaaggacttgcaataacatttgtttcctctgcc
tcagactctgatgttcttaatcaagtgcaagaaagattcgaggttgacataaaggagctt
cctgagcagattgatacttcgacatatatgccttcgtaa

DBGET integrated database retrieval system