KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326201
Entry
4326201           CDS       T01015                                 
Name
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4326201
   00052 Galactose metabolism
    4326201
   00500 Starch and sucrose metabolism
    4326201
   00520 Amino sugar and nucleotide sugar metabolism
    4326201
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     4326201
SSDB
Motif
Pfam: UDPGP Vir_act_alpha_C
Other DBs
NCBI-GeneID: 4326201
NCBI-ProteinID: XP_015633482
LinkDB
Position
1:8960848..8968607
AA seq 758 aa
MAHAVESMEKLRAAVSKLDEMSDEDKDSFMHLVSRYLIREEKEMIDWNKVERPTPEMVVP
YDSLVQAPRDIPEIRNLLNKLAVLKLNGGLGTTMECVAPKCTIEVRSGLTFLDLAIMQTE
FLNKKYGCSVPILLMNSFNTSLVNKIVEKYTNIEIHTFNQNKYPRIITEKFLPLSSEGST
GSHCWYPPGHGDVFFSLCKSGILDTMLSQGKEYVFIASSENLGATVDIEILNHLIHNKNE
YCMEVTPKTSADVKGGSLICYEGLMQLLEIFQVPYENVDEFQSIENFNMLNTNNLRVNLK
AIKRLVKAEALKMEIIPNLKEVDGVKVLQLEKEAGSAIQCFEKAIGVTVPRSRFLAVKNT
SDLFLILSDLYIVMDGTVTRNPARDNSTNPLIDLGPEFRKVDSFLDRFKSIPSIVALDSL
KISGDVWFGSRITLKGEVTIAAQLGLKLDILDGSVFDNKHSTHSSGAIKYTMKLDEGADC
ASIDSALNRLNPGSTLILKKDDFYRYIDPIQARNRAMFHSESSKPSSSNNELLQDNGTPF
TPNDNSDRIQPLPLAPFSSSLGSSSLLPLYHSRARRAPYWYTRFIFVNPRGALHSQFRWL
WGRIKFSSAKDLAIFYGIYHIVLYGIDCIITATLKDNWFAKLVQGKLWLIILVFHQFKLL
SRRRLRWGERRRRTLRSIHQDIQSYLDNYSDSDMWHLIVHSVARVISNVLEDVNRKYMKN
HYLGFLAIHSTVFAIEVIGSYAVELNYDIEHYAEPPEL
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcgcacgccgtggagtccatggagaagcttcgagccgccgtgtccaagctcgacgag
atgagtgacgaagacaaggactccttcatgcacctcgtctctcgctacctgatcagggag
gagaaagagatgatcgactggaacaaagttgagcgacccacccctgagatggtggtgccg
tacgactcactggtgcaggctccccgagatatccctgagattagaaatctgcttaataaa
cttgctgtgctcaagcttaatggaggacttgggacgaccatggagtgcgttgctcccaag
tgtacgattgaagtccgcagcggccttacctttcttgaccttgctataatgcagactgag
tttctgaacaagaagtatggatgcagcgttcctatccttctaatgaactcattcaacacc
agccttgtgaataagatcgtggagaagtacacaaacattgaaattcacactttcaatcag
aataagtaccctcgtatcattactgaaaagttcttgccactttcaagcgaaggaagtaca
gggtcccattgctggtatcccccaggccacggtgatgtgtttttctcattgtgcaaaagt
ggaatacttgataccatgttgtcacagggcaaggaatatgtcttcatagcgagttcagag
aacttgggcgctacagtcgatattgaaatcctaaaccacttgatccataacaaaaatgag
tactgcatggaggttactccaaaaacatcggctgatgttaaaggtggttctctcatatgt
tatgaagggttaatgcagctgttggagatttttcaggtcccttatgagaatgtagatgaa
ttccagtcaattgagaacttcaatatgctcaacactaataacctgcgggtgaacttgaag
gccatcaagaggctggtaaaagctgaagcactaaagatggaaatcattccaaacctaaag
gaagttgatggtgtgaaagtcttgcaacttgaaaaggaagctggttcagcaatacagtgc
tttgaaaaggccattggtgttactgttcctcgctcaaggttccttgcagtaaaaaataca
tccgatctgttcctcatcctgtctgatttatatattgtgatggatggcactgtaacccgt
aacccagctagagataattcaacaaaccccttgattgatcttggacctgagttcagaaag
gttgacagtttccttgaccgatttaaatcaatccctagtattgttgcgcttgatagcttg
aaaatctctggggatgtttggttcggttcaagaattactctcaagggtgaggtgacgatt
gctgcccagttagggttaaagctggatattcttgatggcagtgtttttgataacaagcat
tcaacacatagttctggagccatcaaatatacaatgaaattggatgagggagcggactgt
gcatctattgattctgcgctcaatcggctgaacccaggatcaactttgatcctaaagaaa
gatgatttctatcgatacattgacccaattcaggcacggaaccgggcaatgttccattca
gaaagcagtaagccctcatccagcaacaacgagttactccaagacaatggaactcccttc
actccaaatgataatagtgacaggatacaacccctaccccttgctcccttctcttcttca
cttggctcttcatcactgcttcccttatatcactctagagcccgtcgagcgccttactgg
tatacacgatttattttcgtgaatccgcgaggggcactgcattcacaatttaggtggctg
tgggggcgtataaagtttagcagtgcgaaagatcttgccatattttatggtatttatcat
atcgtactgtatggaatagattgcattatcacagcaactttgaaggacaattggtttgcc
aaactggtgcaaggaaagctgtggcttataatattggtctttcatcagttcaagttgctt
agccgccggcgcctccgctggggtgagaggaggaggaggacgctcagatctattcatcag
gatatccagagttacttggacaattactctgactccgacatgtggcatttgattgtacac
agtgttgctagagtgatatccaatgtgctggaagatgtaaaccgcaaatatatgaagaat
cactacctaggctttcttgccatacattcaacggtgtttgccatcgaagtgataggttca
tacgctgttgaacttaattacgacattgagcactatgcagaaccgccagagttatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328091
Entry
4328091           CDS       T01015                                 
Name
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4328091
   00052 Galactose metabolism
    4328091
   00500 Starch and sucrose metabolism
    4328091
   00520 Amino sugar and nucleotide sugar metabolism
    4328091
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     4328091
SSDB
Motif
Pfam: UDPGP DUF1647
Other DBs
NCBI-GeneID: 4328091
NCBI-ProteinID: XP_015627275
UniProt: Q6ZGL5 Q0E4I5 A0A1L2JID0
LinkDB
Position
2:complement(926052..930040)
AA seq 467 aa
MADEKLAKLREAVAGLSQISDNEKSGFISLVARYLSGEEEHVEWAKIHTPTDEVVVPYDT
LAAPPEDLEETKKLLNKLAVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIESLN
KKYGSNVPLLLMNSFNTHEDTLKIVEKYTNSNIEVHTFNQSQYPRVVADEFLPWPSKGKT
CKDGWYPPGHGDIFPSLMNSGKLDLLLSQGKEYVFIANSDNLGAIVDMKILNHLIHKQNE
YCMEVTPKTLADVKGGTLISYEDKVQLLEIAQVPDAHVNEFKSIEKFKIFNTNNLWVNLK
AIKRLVEADALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFDHAIGINVPRSRFLPVKAT
SDLQLVQSDLYTLVDGFVTRNPARTNPSNPSIELGPEFKKVGCFLGRFKSIPSIVELDTL
KVSGDVWFGSSITLKGKVTITAQPGVKLEIPDGAVIENKDINGPEDL
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcggacgagaagctcgccaagctgcgtgaagccgtcgccggcctctcgcagatcagt
gacaacgagaagtccgggttcatcagcctcgtcgcccgctacctcagtggcgaggaggag
catgtggaatgggcaaagatccacacgccgacggacgaggtggtggtgccgtacgacacc
ctggcggcgccgccggaggacttggaggagaccaagaagctgctcaacaagctcgccgtg
ctcaagctcaacggcggcctcggcaccaccatgggatgcaccggaccaaaatcggtcatc
gaagtgcgcaacggattcacattcctcgacttgattgtgatccagatcgagtccctcaac
aagaagtatggcagcaatgtcccactgcttctgatgaactcattcaacacccatgaagac
accttgaagattgttgagaaatacaccaattcgaacattgaagtccatactttcaatcag
agccagtatcctcgtgtggtagccgatgagttcttgccatggccttccaaggggaagacc
tgcaaggatggctggtaccctcctggccatggtgatatcttcccatccctgatgaacagt
ggcaagcttgatttgttactttcacagggaaaggagtatgtgttcattgcaaactcagat
aacttgggtgctatagtggacatgaagatactgaaccatttgatccacaaacagaatgaa
tattgcatggaggttaccccgaaaactctggctgatgttaaaggtggcacactgatctca
tatgaagacaaggttcagctcctggagattgcacaagttcctgatgcacatgtgaatgaa
ttcaaatccatcgagaaattcaagatcttcaacacgaacaatctatgggtgaacttgaag
gctatcaagcgccttgttgaggctgatgcactaaagatggagatcattccaaaccctaag
gaagtggatggagttaaagttcttcagttggaaacagcagctggtgcagcaatcaggttc
tttgatcacgcaattggtatcaatgttccaaggtcccggttcctaccagtgaaggcaaca
tcagatttgcagctagtacagtctgatctatataccttggttgatggctttgttacacgc
aacccggccagaacaaacccatcgaatccctcaattgaactgggtccagagttcaagaag
gtcgggtgtttccttggtcgcttcaagtcaatccccagcattgttgagcttgacaccttg
aaggtttccggtgatgtttggtttggctctagcatcacattgaagggcaaggtgaccatc
acagcccaacctggtgtcaaactggaaatcccagatggagcagtgatcgagaacaaggat
atcaatggccccgaggacctttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347800
Entry
4347800           CDS       T01015                                 
Name
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa00052  Galactose metabolism
osa00500  Starch and sucrose metabolism
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
osa01250  Biosynthesis of nucleotide sugars
Module
osa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
osa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4347800
   00052 Galactose metabolism
    4347800
   00500 Starch and sucrose metabolism
    4347800
   00520 Amino sugar and nucleotide sugar metabolism
    4347800
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     4347800
SSDB
Motif
Pfam: UDPGP DUF1647
Other DBs
NCBI-GeneID: 4347800
NCBI-ProteinID: XP_015611911
UniProt: A0A8J8Y9S8 Q93X08
LinkDB
Position
9:21917309..21922417
AA seq 469 aa
MAVTADVKLEGLRAATDKLDQISENEKSGFISLVSRYLSGEAEQIEWSKIQTPTDEVVVP
YDTLSAAPEDLNETKKLLDKLVVLKLNGGLGTTMGCTGPKSVIEVRNGFTFLDLIVIQIE
SLNKKYGCNVPLLLMNSFNTHDDTQKIVEKYSNSNIEIHTFNQSQYPRIVTEDFLPLPSK
GKTGKDGWYPPGHGDVFPSLNNSGKLDTLLAQGKEYVFVANSDNLGAIVDIKILNHLIHN
QNEYCMEVTPKTLADVKGGTLISYEGRVQLLEIAQVPDEHVNEFKSIEKFKIFNTNNLWV
NLKAIKRLVEAEALKMEIIPNPKEVDGVKVLQLETAAGAAIRFFEKAIGINVPRSRFLPV
KATSDLLLVQSDLYTLVDGFVIRNPARTNPSNPSIELGPEFKKVANFLARFKSIPSIVEL
DTLKVSGDVWFGSGVTLKGKVTITAKSGKLEIPDGAVLENKDINGPEDL
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggcggtcaccgccgacgtgaagctcgagggcctccgcgccgccaccgacaagctcgac
cagatcagcgagaacgagaagtccgggttcatcagcctcgtttcgcgctacctcagcggc
gaggcggagcagatcgagtggagtaagatccagaccccgaccgacgaggtggtggttccc
tacgacacgctctcggctgctcccgaagatctcaacgagacgaagaagctgctcgacaaa
ctcgtcgtgctcaagctcaatggaggcctcgggacgaccatgggctgcactggtcccaag
tctgtcattgaagtccgcaatggctttacgtttctagaccttattgtgattcaaattgag
tccctgaacaagaagtatggatgcaatgtccctttgcttctaatgaactcattcaacact
catgatgacacacagaagattgttgagaagtactccaactccaacattgaaattcacact
ttcaaccagagccaatatcctcgcattgttactgaagacttcttgccacttccaagcaag
gggaagactggcaaggatggctggtatcccccaggccatggtgatgtgttcccctccttg
aataacagtggaaaacttgataccttgttggcacagggcaaggagtatgtctttgtcgcg
aactcggacaacttgggtgctattgttgacatcaagatcttaaaccacctgatccataac
cagaacgagtactgtatggaggttactcctaaaacattggctgatgttaaaggtggtacc
ctcatctcttacgaagggagagttcagctgttggagattgctcaagtccctgatgagcat
gtgaatgaattcaagtcaattgagaagttcaagatcttcaataccaacaacctgtgggtg
aacttgaaggccatcaagaggctggtagaagctgaagcacttaagatggaaatcattcct
aaccctaaggaagttgatggtgtgaaagttctgcaactcgaaactgcagctggagcagcc
attcggttctttgaaaaagcaattggcattaatgttccccgctcgagatttctgccagtc
aaggctacatctgatttgttgcttgtacagtctgatttgtacaccttggtcgatggcttt
gtcatccgcaacccagccagaacaaacccatcaaacccttcgattgagcttggacctgag
ttcaagaaggttgccaatttcctggcccggtttaagtcaatccccagcattgtcgagctt
gacaccttgaaggtctctggtgatgtctggttcggctctggagttacactcaagggtaag
gtgaccatcaccgccaagtcagggaagttggagatcccagatggagccgtgcttgagaac
aaggacatcaacggtccggaggatctttga

DBGET integrated database retrieval system