KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326207
Entry
4326207           CDS       T01015                                 
Name
(RefSeq) geranylgeranyl diphosphate reductase
  KO
K10960  geranylgeranyl diphosphate/geranylgeranyl-bacteriochlorophyllide a reductase [EC:1.3.1.83 1.3.1.111]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4326207
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4326207
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.83  geranylgeranyl diphosphate reductase
     4326207
    1.3.1.111  geranylgeranyl-bacteriochlorophyllide a reductase
     4326207
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox_2 FAD_oxidored HI0933_like NAD_binding_8 GIDA Pyr_redox FAD_binding_2 Lycopene_cycl NAD_binding_9 AlaDh_PNT_C 3HCDH_N Pyr_redox_3 Trp_halogenase Thi4 NAD_binding_7
Other DBs
NCBI-GeneID: 4326207
NCBI-ProteinID: XP_015611288
UniProt: A0A0P0V137 Q0JNU7
LinkDB
Position
1:9017893..9019749
AA seq 457 aa
MAAAVAAAACHSPARLVVTCSSSATPAPPRRPLRVAVVGGGPAGASAAEALASAGAQAFL
LERNPSGAKPCGGAIPLCMLDEFAIPRDLVDRRVTRMRVLSPSNLAADFSRALPPGAHIP
MLRREVLDSFLRRRAADAGATLVPGLVTSLSLPADPATDPYLVHYISSDSGGPSSSRCVL
EVDAVIGADGANSRVAREVGAGDYSTAIAFQERIRLPDEAMAYYDDLAEMYVGGDVSPDF
YGWVFPKCDHVAVGTGTVAAKPEIKRLQSGIRARAAGKVAGGRVVRVEAHPIPEHPRPRR
VVGRVALVGDAAGYVTRCSGEGIYFAARSGRLCGRAMADEWRLTGAVTEAGIRAGYLRRW
DDEFRPTFRFLDLLQRVFYGGNAGREALVEMCADEHVQRRTFDSYLHKRMAPAEPWGDLR
LLWRTAAAMVRCGVLGREVERLRRLEQQAADQVLLRH
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggccgccgccgtcgccgccgccgcctgccactccccggcgcgcctcgtggtcacctgc
tcgagctccgccacgcccgcgccgccgcggcgcccgctgcgggtggccgtggtgggcggc
ggccccgcgggcgcgtcggcggccgaggcgctggcgtcggcgggcgcgcaggcgttcctc
ctcgagcgcaacccgtcgggcgccaagccctgcggcggcgccatcccgctctgcatgctc
gacgagttcgccatcccgcgtgacctcgtcgaccgccgcgtcacccgcatgcgcgtcctc
tcgccgtccaacctcgccgccgacttctcccgcgcgctgcccccgggcgcccacatcccc
atgctccgccgcgaggtgctcgactccttcctccgccgccgcgccgccgacgccggcgcc
accctcgtcccgggcctcgtcacctcgctctccctccccgccgaccccgccaccgaccct
tacctcgtccactacatctcctccgactccggtggcccctcctcctcccggtgcgtcctc
gaggtcgacgccgtcatcggcgcggacggcgccaacagccgtgtcgcccgcgaggtcggc
gcgggggactactcgacggccatcgcgttccaggagcgcatccgcctccccgacgaggcc
atggcctactacgacgacctcgccgagatgtacgtcggcggcgacgtctccccggacttc
tacggctgggtcttccccaagtgcgaccacgtcgccgtcgggacgggcacggtggccgcc
aagccggagatcaagaggctccagtcgggcatccgcgcgcgcgcggcgggcaaggtcgcc
ggcggccgcgtggtcagggtggaggcgcacccgatcccggagcacccgcgcccccgccgc
gtggtggggcgcgtggcgctcgtcggcgacgcggcgggctacgtcacccggtgctccggc
gagggcatctacttcgcggccaggtcggggcgcctctgcggccgcgccatggccgacgag
tggcggctcaccggcgcggtgacggaggccgggatacgggcgggatacctccggcggtgg
gacgacgagttccgccccacgttccggttcctggacctgctgcagcgggtgttctacggc
gggaacgccgggagggaggcgctggtggagatgtgcgccgacgagcacgtgcagcgccgg
acgttcgacagctacctgcacaagcggatggcgcccgccgagccgtggggggacctccgc
ctgctgtggcgcacggcggcggccatggtgcgctgcggcgtgctcggcagggaggtcgag
cgcctccgccgtctcgagcagcaggccgccgaccaggtgctcctccgccattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330711
Entry
4330711           CDS       T01015                                 
Name
(RefSeq) geranylgeranyl diphosphate reductase, chloroplastic
  KO
K10960  geranylgeranyl diphosphate/geranylgeranyl-bacteriochlorophyllide a reductase [EC:1.3.1.83 1.3.1.111]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4330711
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4330711
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.83  geranylgeranyl diphosphate reductase
     4330711
    1.3.1.111  geranylgeranyl-bacteriochlorophyllide a reductase
     4330711
SSDB
Motif
Pfam: FAD_binding_3 GIDA Pyr_redox_2 DAO FAD_oxidored Lycopene_cycl NAD_binding_8 Thi4 HI0933_like FAD_binding_2 Pyr_redox Trp_halogenase Pyr_redox_3
Other DBs
NCBI-GeneID: 4330711
NCBI-ProteinID: XP_015627112
UniProt: Q6Z2T6 U5LY03
LinkDB
Position
2:31246201..31248802
AA seq 463 aa
MTSLSSSAAAARATFVMPSSVRGGMSRGRRMARLVTRAAASSPKLPSGRRLRVAVVGGGP
AGGAAAEALAKGGVETVLIERKLDNCKPCGGAIPLCMVSEFDLPLDLVDRKVRKMKMISP
SNVAVDIGGTLAPHEYIGMVRREVLDAYLRSRAEGAGAEVVNGLFLRYEAPKEPNGSYVV
HYNHYDSSNGKAGGEKRTFEVDAIVGADGANSRVAKDMGAGDYEYAIAFQERVKIPDDKM
KYYEERAEMYVGDDVSPDFYGWVFPKCDHVAVGTGTVTHKPDIKKFQAATRLRAKDRIEG
GKIIRVEAHPIPEHPRPKRVAGRVTLVGDAAGYVTKCSGEGIYFAAKSGRMCAEAIVAGS
ANGTRMVEESDLRRYLAEFDRLYWPTYKVLDVLQKVFYRSNAAREAFVEMCADDYVQRMT
FDSYLYKRVVPGNPLDDIKLAVNTIGSLVRATALRREMEKVTL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgacctcgctgtcgtcctccgccgccgcggcgcgcgccaccttcgtcatgccgtcgtcg
gttcgtgggggcatgagccgcggcaggaggatggcgaggctggtgacgcgcgcggcggcg
tcgagcccgaagctcccgagcgggcggcggctgcgggtggcggtggtcggaggcggaccc
gcgggcggcgcggcggcggaggcgctggccaagggcggcgtggagacggtgctcatcgaa
cggaagctggacaactgcaagccctgcggcggggccatcccgctgtgcatggtgtcggag
ttcgacctgccgctggacctcgtcgacaggaaggtgaggaagatgaagatgatttcgccg
tccaacgtcgccgtcgacatcggcggcacgctcgcgccgcacgagtacatcggcatggtc
cgccgcgaggtgctcgacgcctacctccgctcccgcgccgagggggccggcgccgaggtc
gtcaatggtctcttcctgaggtatgaggcgcccaaggaacccaacgggtcgtacgtggtg
cactacaaccactacgacagctccaacggcaaggccggcggcgagaagcggacgttcgag
gtggacgcgatcgtgggcgcggacggcgccaactcccgcgtcgccaaggacatgggcgcc
ggcgactacgagtacgccatcgcgttccaggagcgcgtcaagatccccgacgacaagatg
aagtactacgaggagcgcgccgagatgtacgtcggcgacgacgtctcgccggacttctac
ggctgggtgttccccaagtgcgaccacgtcgccgtcggcaccggcaccgtcacccacaag
cccgacatcaagaagttccaggccgccacccgccttcgcgccaaggaccggatcgagggc
ggcaagatcatccgcgtcgaggctcaccccatccccgagcacccgaggcctaagagggtg
gcggggagggtgacgctggtgggggacgcggcggggtacgtgacaaagtgctccggcgag
gggatctacttcgcggcgaagagcgggcggatgtgcgcggaggcgatcgtggccgggtcg
gcgaacgggacgcggatggtggaggagagcgacctgcgcaggtacctggccgagttcgac
cgcctctactggccgacgtacaaggtgctcgacgtgctccagaaggtgttctaccgctcc
aacgccgcccgcgaggcgttcgtcgagatgtgcgccgacgactacgtccagaggatgacc
ttcgacagctacctctacaagcgcgtcgtgccgggcaacccgctcgacgacatcaagctc
gccgtcaacaccatcggcagcctcgtccgcgccaccgccctccgccgcgagatggagaag
gtcaccttgtga

DBGET integrated database retrieval system