KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326212
Entry
4326212           CDS       T01015                                 
Name
(RefSeq) UBP1-associated protein 2A
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4326212
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4326212
   03041 Spliceosome [BR:osa03041]
    4326212
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4326212
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4326212
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4326212
SSDB
Motif
Pfam: RRM_1 RRM_7 CSTF2_hinge
Other DBs
NCBI-GeneID: 4326212
NCBI-ProteinID: XP_015621304
UniProt: Q9LJ04
LinkDB
Position
1:complement(9063927..9066803)
AA seq 490 aa
MGKKRKLDSKSPAAARSAAARAAAAAAAAAAAAAVAEPSSQPEALAEDPAPSSQPLGLSS
EGAGERMMSREAGGGEEEEVEEVEVEEEVEVDEDEDGEGEGEEEEEAAERDADSIQALLN
SFPKDQLVELLSAAALSHEDVLTAVHRAADADPALRKIFVHGLGWDATAETLTEAFSAYG
EIEDLRVVTDRATGKCKGYGFILFSRRSGARAALREPQKKIGNRTTACQLASVGPVPPGG
MATNPAPAVAPAPAQLALPPVSEYTQRKIFVSNVGADIDPQKLLQFFSKYGEIEEGPLGL
DKVTGKPKGFALFVYKTLDSAKKALQEPHKQFEGVVLHCQKAIDGPKPNKGGGLGGLYGA
GTSGGRKGAGGYGAHSHSLPGAAVGGHVMPSPVSSLTSLPGVAGGPGVNPALGQALTAIL
ASQGGGLGLNNILGVGANGSGLPNPGASAGLGSSGLPGMPGAGGYLGGYGGGGGYGSTPP
GGPGRNYMGH
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgggcaagaagcggaagctcgattccaaatcccccgccgccgctaggtccgcagccgcc
agggccgcagcagccgcagccgccgccgccgccgccgccgccgtcgccgagccctcctcc
cagcccgaagccctagccgaggacccggccccctcgtcgcagcccctgggcctatccagc
gagggcgcgggggagaggatgatgtcccgtgaggctggcggtggcgaggaagaggaggtg
gaggaggtcgaggtggaggaggaggtggaggtcgacgaggacgaggatggggagggggag
ggggaggaggaggaggaggcggcggagagggacgccgactcgatccaggcgctgctgaat
tcgttccccaaggaccagctcgttgagctgctcagcgccgcggcgctcagccacgaggac
gtgctcacggccgtccaccgcgcggccgacgccgacccggcgctgcggaagatcttcgtc
cacggcctcggctgggacgccaccgcggagaccctcaccgaggcgttcagcgcctacggc
gagatcgaggacctcagggtcgtcaccgaccgcgccacgggcaagtgcaagggctacggt
ttcatcctcttcagccgccggtccggcgcccgcgcggcgctccgtgagccccagaagaag
attggcaaccgcaccacggcctgccagctcgcctctgttggtcctgtgccgccgggcggc
atggccactaaccctgccccagcggtagccccagccccagcgcagctggcattgccgcca
gtgtcggagtacacgcagcggaaaatttttgtcagcaatgtcggcgcagacatagacccg
cagaaactgctgcagttcttttcaaagtatggtgagattgaggagggtcctcttgggctc
gataaggttaccgggaagccgaagggctttgctctatttgtctacaagaccctcgatagt
gctaagaaagcgcttcaggagccacacaagcaattcgagggggttgtgctgcactgccag
aaggcaattgatggaccaaagcccaacaaaggtggaggacttgggggtttgtatggtgct
ggcacttcaggcgggaggaaaggcgctggtggttatggagctcatagtcattctttgcct
ggtgctgctgttgggggccatgtgatgccatctccagtatccagtttgacttcattgcca
ggtgtagctggtggcccaggggtgaatcctgctctggggcaggccttgacagctatcctt
gcctcccagggtggagggttgggtctgaacaacatcctgggagttggtgcaaatggttca
gggttgcctaacccaggggcttctgcaggactgggtagtagtggtttgcctgggatgcct
ggtgctggtggttatttgggcggctatgggggtggtggtgggtatggcagtactccacca
ggaggcccaggaagaaattacatgggtcattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326641
Entry
4326641           CDS       T01015                                 
Name
(RefSeq) UBP1-associated protein 2C
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4326641
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4326641
   03041 Spliceosome [BR:osa03041]
    4326641
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4326641
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4326641
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4326641
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 4326641
NCBI-ProteinID: XP_015619444
UniProt: Q0JL97 A0A0P0V565
LinkDB
Position
1:complement(24366675..24372199)
AA seq 447 aa
MDPYPKKRKPDENGAAVASSPAAGAAALGLTRDDLLRLVEPLSRDQLADIAATAALASGV
ALDAVRAAADRDPALRKLFVRGLGWETNSDSLRAIFSAFGDLEEAVVITDKSTGRSKGYG
FVTFRHADSAVLALKEPSKKIDGRMTVTQLAAAGAAGGASGGAAGAGGAPAADVSLRKIF
VGNVPADMPSERLLAHFAAYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQASLVDSVK
VIDGHQLVCKLAIEGKKGKQSQQQQQQSGPGGAQPPQMLQGGPPDMPGSGLGLGGPQMGA
QYGGPGSLSSYGAFGGVGAGLGGPNPYANLPSSMGGGGAGLGSLGNQMPSGMGGAGAGAY
GPGGLGGGSFGGSSQFGAGGMGAYGGLGMGGASSLYRMQQGSGGLPSGGYGEGNYPLPGP
GFRGQEGGMSPGPGGRAPMYPNVPPYF
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggatccctaccccaagaagcgcaagcccgacgagaacggcgcggccgtggcctcctcc
ccggccgcgggcgccgccgcgctcggcctcacccgcgacgacctcctccgcctcgtcgag
ccgctctcccgggaccagctcgccgacatcgccgccaccgccgcgctcgcctcgggggtg
gccctcgacgccgtgcgcgccgccgccgaccgggacccggccctccgcaagctcttcgtg
cgggggctcggctgggagaccaactccgactcgctccgggccatcttctccgccttcggc
gacctcgaggaggccgtcgtcatcaccgacaagtccaccggccgctccaagggctacggg
ttcgtcacgttccgccacgccgactccgccgtcctcgccctcaaggagccctcgaagaag
atcgacggccgcatgaccgtcacgcagctcgccgccgccggcgcggccgggggggcgtcg
ggcggggccgccggcgccggtggcgcccccgcggccgacgtctccctccgcaagatcttc
gtcgggaacgtccccgccgacatgccgtcggagcgcctccttgcgcatttcgcagcctat
ggtgagattgaggaggggcctctagggttcgacaagcagacgggcaagttccggggcttt
gccctctttgtgtacaagacacccgagggtgcgcaggcctcgttagtggactcggtgaag
gtgattgacgggcaccagcttgtctgcaagctagcgatcgaagggaaaaaggggaagcaa
tcgcagcagcagcagcagcaatctggacctggtggggctcagccgccccaaatgctccaa
ggcgggccgccggacatgccgggttcagggcttgggcttggtggaccacaaatgggtgcg
cagtatggtggccctgggagtctgtcttcgtatggtgcatttgggggtgtaggcgctggg
ctaggtggtcccaatccgtatgcgaatttgccatcttccatgggcggcggcggagctggg
ttgggttcattgggcaatcagatgccttctgggatgggtggtgctggggctggtgcgtac
gggcctgggggattgggtggtggttcatttgggggctcatcccagtttggtgctggtggg
atgggggcttatgggggtctaggcatgggtggagcctcatcactgtaccgcatgcaacag
ggttcgggtgggcttccttctggcgggtatggtgagggtaactaccctcttccagggcct
ggtttccggggtcaggagggtggaatgtcacctggaccaggtggtagagctcctatgtac
cccaatgtgcctccttatttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328758
Entry
4328758           CDS       T01015                                 
Name
(RefSeq) glycine-rich RNA-binding protein 3, mitochondrial
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328758
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4328758
   03041 Spliceosome [BR:osa03041]
    4328758
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4328758
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4328758
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4328758
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 Nup35_RRM
Other DBs
NCBI-GeneID: 4328758
NCBI-ProteinID: XP_015626578
UniProt: Q6YW36 Q6YVH3
LinkDB
Position
2:complement(6784301..6788343)
AA seq 397 aa
MAGYPEENQHGMNGYEEEEEVEEVEGFDEEGRPGRRGGGGRDGGDGGAYGDASGDDGRAP
GGDSSGKIFVGGVAWETTEESFSKHFEKYGAITDSVIMKDKHTKMPRGFGFVTFSDPSVI
DKVLEDEHVIDGRTVEVKRTVPREEMSSKDGPKTRKIFVGGLPSSLTEDELREHFSPYGK
IVEHQIMLDHSTGRSRGFGFVTFESEDSVERVISEGRMRDLGGKQVEIKKAEPKKHGGDH
SSNGRSSHGSGGGYRSSYRSGGAAASGGGGGGGGGGSGSSGGYGYGAGYRSAGGGYYDST
AYGYGRGGYGYGGNAGFGSGYGGGYGGSLYGGAYGAYGAYGGGAYGGGAYGGGAYGGGAY
GGAPGAYGGAGGYGSYGGAGAGGAGGRGSSRYHPYGK
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcggggtacccggaggagaaccagcacgggatgaacgggtacgaggaggaggaggag
gtggaggaggtggaggggttcgacgaggagggtcgacccggtagacggggcggcggcggt
cgggatgggggcgatggcggcgcgtatggcgacgccagcggggacgacgggagggcgccc
ggcggggactcgtcggggaagattttcgtcggaggcgttgcttgggagacaaccgaagaa
tcattctccaagcattttgagaagtatggggctataactgattctgtaattatgaaggac
aagcatactaagatgcctcgtggatttggatttgttacattttccgatccatctgttata
gacaaggttttggaggatgagcacgttatagatggaagaacggttgaagttaaaaggaca
gtcccaagggaagaaatgtcatcaaaagatggtccaaagacaaggaaaatctttgttggt
ggattaccttcatcactaactgaagatgagttgagggagcacttctccccatatggtaag
attgttgaacatcaaataatgcttgatcatagcactgggcgttctagaggatttggtttt
gtcacttttgaaagtgaggattctgtggaaagggttatatcagagggaagaatgcgtgac
cttggtggaaagcaggttgaaataaagaaggctgagccaaagaaacatggtggtgatcac
agtagtaatgggagatctagtcatgggagcgggggtggttaccgcagttcataccgtagt
ggtggagctgctgcttctggtggtggaggcggaggtggtggtggcggcagtggcagcagt
ggtggctatgggtatggtgctggttaccgatcagctggaggaggttattatgatagtact
gcatatggttatggcagaggagggtatggctatggaggtaatgctggatttggatcagga
tatggtggtggttatggtggctccttgtatggaggtgcctatggtgcttatggggcatat
ggtggtggtgcctatggagggggtgcctatggcggaggtgcttatggtggtggtgcctat
ggtggcgctccgggtgcctatggtggtgctggaggatatggcagttatggtggagctgga
gcaggaggtgctggtgggcggggttccagcaggtaccatccatatgggaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329903
Entry
4329903           CDS       T01015                                 
Name
(RefSeq) UBP1-associated protein 2B
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329903
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329903
   03041 Spliceosome [BR:osa03041]
    4329903
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4329903
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4329903
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4329903
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 4329903
NCBI-ProteinID: XP_015627228
LinkDB
Position
2:23581826..23583942
AA seq 385 aa
MARKRKRGRTRRATQAEAEVEQSEREMVGDEAVEEEEDDDVTKMNPPPATAGEREEEEEE
EGIEGLLEPFTRNELLDLLVEACLRNPALRSRLAATAESDAAHRRLFVHGLSPGVTAAAM
AAAFAPFGALDECHAVADRATGRCRGYGFVTFRRRSAARRALAADASSRLAVGGRPVACQ
LASLGPTSPDRKLFVDNVPARAAHDELRRLFSRFGEIEAGPLGADRATGQFRGYAIFFYK
YPEGLTKALEERKVVFDGCELHCRRAHRVNKEKHLMTMPADAGAQSNGFENAASPIIHVQ
PKELALASTTQTPLGSNRPVEMMAKGPRSGTVPFRQNAGAGLLGACPVATVTSSTPDQST
PVSHSGASISTPRTAQRLAKSGAQG
NT seq 1158 nt   +upstreamnt  +downstreamnt
atggctcggaagaggaagcgggggcggacgcggcgcgccacgcaggcggaggcggaagtg
gagcaatccgagcgagaaatggtaggggatgaagccgtggaggaggaggaggacgacgac
gtcacgaagatgaatccgccgccggcgacggccggtgagcgcgaggaggaggaggaggag
gaaggaatcgaggggcttctggagccgttcaccaggaacgagctcctcgacctcctggtc
gaggcctgcctccggaaccccgccctgcgctcccgcctcgccgccaccgcggagtccgac
gccgcccaccgccgcctcttcgtgcacggcctcagccccggcgtcaccgccgccgcgatg
gccgccgccttcgcccccttcggcgcgctcgacgagtgccacgccgtcgccgaccgcgcc
accggccgctgccgcggctacggattcgtcaccttccgccgccgctccgccgcgcgccgc
gcgctcgccgccgacgcctcctctaggctcgccgtgggcggccgccccgtcgcgtgccag
ctcgcgtcgctcggccccacctcccccgaccgcaagctcttcgtggacaacgtgcccgcg
cgcgccgcccacgacgagctgaggaggctcttctccaggttcggggagatcgaggcgggg
cctctcggcgccgaccgcgccaccggccagttccgcggctacgccatcttcttctacaag
taccccgaggggcttacgaaggctctcgaggagcgcaaggtggtgttcgacgggtgcgag
ctccattgccggcgcgctcacagagtgaacaaggagaagcatctcatgaccatgcctgca
gatgcaggggcacagagcaatggcttcgagaacgctgcctcacccatcatccatgtccag
ccgaaggagcttgcattggcatccaccacgcagacgcctcttggatcaaatcggccagtt
gagatgatggcgaaggggcctagatcaggcacggttccctttcgtcagaacgctggagct
ggtctcttgggtgcatgccctgtggctacggtcacgtcctctacgccagatcagagcaca
ccggttagccattctggagcttcaatttccacaccccggactgctcagagattggctaaa
tcaggagcacaaggatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337147
Entry
4337147           CDS       T01015                                 
Name
(RefSeq) UBP1-associated protein 2B
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4337147
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4337147
   03041 Spliceosome [BR:osa03041]
    4337147
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4337147
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4337147
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4337147
SSDB
Motif
Pfam: RRM_1 RRM_7 SNAPC2
Other DBs
NCBI-GeneID: 4337147
NCBI-ProteinID: XP_015635574
UniProt: Q0J9Q1 A0A5S6R7M2
LinkDB
Position
4:complement(32387913..32392487)
AA seq 515 aa
MAPKKRKADPAESPVASSEAGAGTNHHQETPSSELKPRGTIYFPITDDPPEPSAEGGAEG
EDGAGGDDDEEDIAKLLEPLSREQLVALLRTAAETTPATMAAVRRAAEADPASRKLFVHG
LGWGAGADDLRSAFSRFGELEDCRVISDKQSGRSKGYGFVLFRSRRSALRALRRPQLQIG
GRLAFCHLAASGPAPPTSQSQNPSSNTNANSGAANNAGSASSSQPDNMQRKIFVGNVHAD
VDVDRLYEYFSQFGEIEEGPLGFDKTTGKPKGFALFVYKSVESARRALEEPTRNFDGKML
NVQKAIDGRTKNTPGMNANSNPSGTAASAAAAAAAAQMTAPATAAITPYDASAYGATAVP
DLGYAQQAAMLGLGAQQQAFAQPNAAMLAMMAAAMQNPAMLATLNPAFAAAALGAGGQQV
HAAGIPGFGAQGFGTQGFAAGAAAFPNAAGVQAPPGFQGPPGFQTSAGFQVGQAASQAGT
AAAAAAGAAGYQAAAAGQGQVPGTQIGGAGFQGGF
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggctccgaagaagcgaaaggcggatccggcggagtccccggtagcctcgtcggaggcc
ggcgccggcaccaaccaccaccaggagacgccctcctcggagctcaagccccgggggacc
atctacttccccatcaccgacgaccccccggagccgagcgcagagggcggcgccgagggg
gaggacggcgccggaggggacgacgatgaggaggacatcgcgaagctgctcgagcccctg
tcgcgggagcagctggtggcgctgctccgcacggccgcggagactacccccgcgacgatg
gcggccgtgcggcgcgcggcggaggccgaccccgcgagcaggaagctcttcgtccacggc
ctcggctggggcgccggagccgacgacctccgctccgcgttctcccgcttcggcgagctc
gaggactgccgtgtcatctccgacaagcaatctggcagatctaagggctacggcttcgtc
ctcttccgctcccgccgctccgcgctccgcgccctccgccgcccccagctccaaatcggc
ggccgccttgctttctgccatctcgctgcctcgggtcctgcccctccgacctcccagtcc
cagaaccctagctccaacaccaacgccaactccggtgcggccaataacgctggttctgcg
tcgtcttcacaacctgacaacatgcaacgcaaaatctttgttggtaacgtgcatgctgat
gtcgatgttgaccgcctgtatgagtacttctcgcaatttggtgagattgaggaggggcca
ttgggatttgacaagaccactggcaagcctaaggggtttgcgctgttcgtctacaagtca
gtggagagcgcccgccgtgcgctggaggagccaacaaggaactttgatggcaaaatgctc
aatgtgcagaaggctatagatggcaggaccaagaacacacctgggatgaatgcaaattct
aaccctagtggtaccgctgcctcggcagcagctgctgctgcagctgcacagatgactgct
cctgctactgctgcaattacaccgtatgatgcatcagcttatggtgctactgccgttcct
gacttgggttatgcgcagcaagcggctatgttgggattgggtgcacagcagcaggcgttt
gcacaacccaatgctgcaatgcttgccatgatggcagcagctatgcaaaacccagctatg
ctcgcaacgctgaaccctgcttttgctgctgctgcattgggtgctgggggccagcaggtg
cacgcggctggtattccaggttttggagctcagggttttgggacacagggctttgcagca
ggtgccgccgcttttccaaatgcagcgggtgttcaagctcctcctggttttcagggtccg
cctgggttccagacttctgctgggtttcaggttggccaagcagcttcacaagcgggtact
gctgcggctgctgccgccggtgctgctggttatcaggctgctgctgctgggcagggccaa
gtgcccggaacgcaaattgggggtgctggttttcagggtggattttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341330
Entry
4341330           CDS       T01015                                 
Name
(RefSeq) heterogeneous nuclear ribonucleoprotein 1
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4341330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4341330
   03041 Spliceosome [BR:osa03041]
    4341330
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4341330
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4341330
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4341330
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM_2 Nup35_RRM Med8 Calcipressin eIF-3c_N
Other DBs
NCBI-GeneID: 4341330
NCBI-ProteinID: XP_015644287
LinkDB
Position
6:21818501..21822470
AA seq 407 aa
MAGYGEENQNGMNGYEEEEEEEEVEEVEEEVEEEEEEEEEEEGADATAAAADAAEEVAEE
RRGGGGEVEGVGNGEEAGRTAGGGEGGDSSGKIFVGGVAWETTEESFTKHFEKYGAISDS
VIMKDKHTKMPRGFGFVTFSDPSVIDKVLQDEHTIDGRTVEVKRTVPREEMSSKDGPKTR
KIFVGGIPPSLTEDKLKEHFSSYGKVVEHQIMLDHGTGRSRGFGFVTFENEDAVERVMSE
GRMHDLAGKQVEIKKAEPKKPGGGDSSSNGRHSHGSGGGHRSSYRGSGGGNSGSSSSGGY
GGYGGGYRSAAAAYYGSTGYAGYGRGYGYGGNPAFGSGFGSGYGGSMYGGPYGAYGAYGG
AYGGGGAYGAPGGYGAGGYGAYGGAGGMGGGGSTSGRGSSRYHPYGK
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggcggggtacggggaggagaaccagaacggcatgaacgggtacgaggaggaggaggag
gaagaggaggtggaggaggtcgaggaagaggtggaggaggaggaggaggaagaggaggag
gaggagggggctgatgccaccgccgcggctgccgatgcggcggaggaggttgcagaggag
aggcgaggcggaggtggagaagtggagggcgtcggcaatggcgaggaagcggggaggact
gcgggtggtggagagggcggtgattcgtcggggaaaatttttgttggaggtgtagcctgg
gagacaactgaagaatcgttcaccaagcattttgagaaatatggagctatatctgattct
gtgatcatgaaagacaagcatacaaagatgcctcgtggatttggttttgttacattttcg
gatccatctgttattgacaaggttctgcaagatgaacacactatagatggaagaacagtt
gaagttaaaaggactgtcccgagggaggaaatgtcgtcgaaagatggtcctaaaacgaga
aaaatctttgttggtggtattccaccatctcttactgaagataaattgaaggagcatttc
tcttcatatgggaaggtagttgagcatcagataatgcttgaccatggcactgggcggtca
cgaggctttggctttgtcacatttgaaaatgaggacgctgttgaaagggttatgtcagaa
gggagaatgcatgatcttgcagggaaacaggttgaaataaagaaggctgagcctaagaaa
cctggcgggggtgattctagctctaatgggagacatagtcacgggagtggtggtggccac
cgtagttcttaccgtggtagtggtggtggcaattctggaagcagcagcagcggtggctat
ggtggatatggtggtggctatcggtcagctgctgcagcttattacggtagcacaggttat
gctggctatggcagaggttatggatatggaggtaaccccgcatttgggtcaggctttggc
tctggctatggtggttcaatgtatggaggtccatatggtgcctatggtgcatatggtggt
gcctatggaggtggtggtgcatatggtgcaccgggtggctacggtgcaggaggatatggt
gcttatggcggagctggaggtatgggcggtggtgggagcacaagtggtagaggctcgagc
agataccacccgtacggaaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343831
Entry
4343831           CDS       T01015                                 
Name
(RefSeq) glycine-rich RNA-binding protein 2, mitochondrial
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4343831
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4343831
   03041 Spliceosome [BR:osa03041]
    4343831
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4343831
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4343831
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4343831
SSDB
Motif
Pfam: RRM_1 RRM_7 RRM_occluded
Other DBs
NCBI-GeneID: 4343831
NCBI-ProteinID: XP_015645572
UniProt: B9FYA6 Q0D4V3
LinkDB
Position
7:complement(24611193..24614169)
AA seq 238 aa
MAFAGRVVNALRRTSVSSNPSLLQAVRCMSSKLFVGGLSYATDDTTLKDVFSHYGDVLEA
RIIIDRDTGKSKGYGFITYTSSEEAAAAVTAMDGKDLQGRIVRVSTANDRAGGIRGGGGF
GAGGYGSGGGYSSGGGYGTGEYGRGGGYAGNGGYGGRASEYGGYGAGGYSSSGGYNATSV
LHGNAGGYGSSGVSHGNAGDYRSSDVYNTTNTYGAGNFSHSGQSGGSFGGNNGGISGG
NT seq 717 nt   +upstreamnt  +downstreamnt
atggctttcgctggtagagttgtgaatgcgctcaggaggacttcggtctcgtccaacccg
tcgctgctccaggcagtaagatgcatgtcctcaaagcttttcgttggaggactttcgtat
gccacagacgacaccaccctcaaggatgtgttttctcactacggcgatgttcttgaagct
aggatcatcattgatagggacacaggaaagtcaaaagggtatggatttataacttacaca
tcaagcgaggaagctgcggctgccgttactgccatggatggcaaggatcttcaaggacga
attgtaagggtcagcaccgccaatgaccgtgctggtggaatacgtggaggtggtggattt
ggcgctggtggttatggaagtggcggtggatatagcagtggtggtggatatggtactggt
gagtatggcagaggtggtggatatgctggcaatggtggatacggtggcagggcttctgaa
tatggtggttatggtgctgggggatacagcagtagtggaggctataatgctaccagtgtt
cttcatggaaatgctggtggctacggtagctctggtgtgtcccatggaaatgctggtgac
tacagaagctctgatgtttacaatactaccaacacctatggcgctggcaacttcagccat
agtggtcagtccggtggcagcttcggtggaaacaacggtggaattagtggtggatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345254
Entry
4345254           CDS       T01015                                 
Name
(RefSeq) heterogeneous nuclear ribonucleoprotein 1
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4345254
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4345254
   03041 Spliceosome [BR:osa03041]
    4345254
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4345254
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4345254
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4345254
SSDB
Motif
Pfam: RRM_1 RRM_7 BRAP2 HSP90
Other DBs
NCBI-GeneID: 4345254
NCBI-ProteinID: XP_015651001
UniProt: Q6ZCL1 Q6Z0P6
LinkDB
Position
8:13930442..13934687
AA seq 350 aa
MAGGKMKEHDGASPAKIFIGGLPKDTTMGTFKEYFGKYGEIVDAVIMKDRFTQKPRGFGF
ITFADPAVVDRVIEDNHVINGKEVEIKRTIPKGAAPLKDFKTKKIFVGGLPSALKEDEFK
EFFSKFGKVVEHEIIRDHSTNRSRGFGFVVFDAEKTVDELLAKKGNMIDLNGSQVEIKKA
EPKKPSNPPHRSFDSEPRGRPHADGYDGLGNSYNYGGSFGPYRSPGSFGTRPGGYSSSYG
PGDYGSGYGAYGGALGGYRGESSLYSSRFGSTYGGSFGGGYAGGSYAGGLGGAYGRDAGG
FGGSSYGPSYDSSSGPGAGVGFGTGGLYGARGGYGSSGAGASGRYHPYAR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggccggcggcaagatgaaggagcacgacggcgccagcccagccaaaatcttcatcggc
gggctgcctaaggacaccaccatgggtactttcaaagaatactttgggaagtatggggag
atagttgatgccgtcataatgaaggaccgctttacccagaaacccagaggatttggattt
attacctttgcagatcctgctgttgttgacagagtgattgaggacaaccatgttattaat
ggaaaggaggttgaaattaagagaactattccaaagggtgctgcccccctaaaagatttc
aagacgaagaaaatatttgttggtggattaccatctgctttgaaagaagatgaattcaag
gagttcttttcgaaatttggaaaggtggtggaacatgaaatcattcgtgaccattcaact
aaccggtcacgaggatttggatttgtagtctttgatgcagaaaaaactgtagatgaatta
ttagctaagaaaggcaatatgattgatctaaatggttctcaggtggagatcaagaaggcc
gaaccaaagaaaccctctaacccacctcatcgttcatttgatagtgaacctaggggccgt
ccacatgcggatggttatgatggattgggcaactcttataattatggtggtagctttggc
ccctatagatcacctggaagttttggcactaggcctggtggttacagtagttcttatggc
cctggtgactatggtagtggctatggtgcttatggtggagcattaggaggatatcgtgga
gaatcatctctctattctagtcgctttggtagcacttatggaggaagctttggtggtggt
tatgctggtggcagttatgctggtggtttaggtggtgcatatgggcgtgatgctgggggt
tttggtggttctagctatggccctagttatgactcttcttcaggtcctggtgctggtgtt
ggctttggcacgggtggactctatggtgctagaggaggctatggtagcagtggtgctggt
gcttctggtcgttatcatccatatgcaaggtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345910
Entry
4345910           CDS       T01015                                 
Name
(RefSeq) heterogeneous nuclear ribonucleoprotein A0
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4345910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4345910
   03041 Spliceosome [BR:osa03041]
    4345910
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4345910
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4345910
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4345910
SSDB
Motif
Pfam: RRM_1 RRM_7 Nup35_RRM
Other DBs
NCBI-GeneID: 4345910
NCBI-ProteinID: XP_015650552
UniProt: Q6Z8U4 A0A0P0XHD9
LinkDB
Position
8:complement(24315376..24318776)
AA seq 362 aa
MGKAEARSREHGGGGGGGSGSAGKIFVGGLPRDTTEADFVKHFGQYGEIVDSVIMRDKHT
SQPRGFGFITYSNPAVVDRVMDDIHEFNGKQVEIKRTIPKDSVQSKDFKTKKIFVGGLPQ
ALTEDDFKHFFQKYGPVVDHQIMRDHQTKRSRGFGFIVFSSDQVVDDLLANGNMIDLAGA
KVEIKKAEPKKSSNPPPSSHGSASRSAYGRDSRGHSSGNDYGGLANAYSNYNSGGFGPYR
NHGVYGGGSLSGYGGIGEYGVQYGRYYPGLGGSGSMPSFGYASRVGPYGGGFDGPYAGGN
LSGYRRGGDESFGGLSSSSFGGAMYGGAAYDPALGGYASGSTPERSRGNLAGGSGRYNPY
GR
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggggaaggcggaggcgaggtccagggagcacggcgggggcggaggaggaggcagcggc
agcgcggggaagatcttcgtcggtggactgccccgtgacaccacggaagcggattttgtg
aagcattttggccagtatggagaaatagttgattcagtgataatgagggataagcacaca
tctcagccaaggggctttggctttattacatattctaaccctgccgttgtggatagagtg
atggatgatatccatgaattcaatggaaagcaagttgaaatcaagagaaccattccaaaa
gattctgtgcaatcaaaggatttcaaaactaaaaagatatttgttggtgggcttcctcaa
gcactgacagaagatgatttcaagcatttcttccagaaatatggccctgtggtggaccat
cagattatgcgtgatcatcaaaccaagcgttcacgaggctttggatttatagtttttagt
tctgatcaggttgtagatgatttattagcaaatggaaatatgattgatcttgctggtgca
aaggtggagatcaagaaagcagaaccaaagaaatcctcaaatccaccaccatcatcacat
ggtagtgcctctagatcagcatatggtagggattctaggggtcattcttctggcaatgac
tatggtggactggccaatgcttatagcaactacaacagtggtggatttgggccttatagg
aaccatggagtttatggtggtggtagtctcagtggttatggtgggataggtgaatatggt
gttcagtatggccgttactatccaggattaggaggatctggaagcatgccttcttttggt
tatgctagtcgtgttgggccgtatggaggaggttttgatggaccttacgctggtgggaac
ttaagtggatacaggcgtggtggtgatgagagctttggtggcctcagtagttctagcttt
ggtggcgctatgtatggcggcgcagcatatgatcctgcactaggtggttatgcatctggt
agcacacctgaaagaagcaggggaaatttggctggtggttcaggccggtacaatccatat
ggacgatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348309
Entry
4348309           CDS       T01015                                 
Name
(RefSeq) glycine-rich RNA-binding protein 10
  KO
K12741  heterogeneous nuclear ribonucleoprotein A1/A3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4348309
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4348309
   03041 Spliceosome [BR:osa03041]
    4348309
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     4348309
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     4348309
Spliceosome [BR:osa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    4348309
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 4348309
NCBI-ProteinID: XP_015614820
UniProt: Q109W0 Q0IYG0
LinkDB
Position
10:complement(8786977..8796618)
AA seq 317 aa
MAFLRKVGNLVRQSAGSGSPLFQAVRCMSSSKLFIGGISYGTDDQSLKEAFANYGEVIEA
RVIVDRTTGRSRGFGFVTYTSTDEAAAAITGMDGKDLQGRIVRVSYAHDRGSRAGGYGGG
GYSGQGTYGGGGGYGGGGYGGQDAYGGRGVGGYSEGGRGYVGGGYGDGNNYGGYNTSGGY
NSEGGRGGYSVFEGGHGYGSGGTGYTGGSGGYNSAPGNYSSDNFNQGGAAPGAYEGANYG
GGNNYMNNATSDDSTGKLDELLNDLKVDGDGKEDGEGKADGAGLVNEDLKGDDGQDELLQ
NDFKDEDVSDDYANKRR
NT seq 954 nt   +upstreamnt  +downstreamnt
atggccttcttgcggaaggttgggaacctcgtcaggcagtccgcaggctcgggctcgccg
ctgttccaggcggtccgatgcatgtcctcctcgaagctcttcatcggaggaatctcttat
ggtactgatgaccagagtctgaaggaagcgtttgctaactacggtgaagtcattgaagct
agggtgattgtggaccgtaccactggacggtcgaggggatttggttttgtaacctacaca
tccacggatgaggctgcagctgccattactggcatggacgggaaggatctgcagggccgg
attgtgcgggtgagttatgctcatgaccgtggtagccgtgctggtggctatggtggtgga
ggctacagtggacagggtacgtatggtggtggcggtggctatggaggtggaggctatggt
ggacaggatgcatatggtggtcgtggtgttggaggctatagtgagggtggccgtgggtat
gttggtggtggatacggtgacggtaacaattacggtgggtataacacaagtggtggatat
aattctgaaggtgggcgtggtggctatagtgtttttgaaggtggacatggctacggtagt
ggcggtactggttacacaggaggcagcggcggatataattcggcccctggaaattacagc
agtgacaacttcaatcaagggggtgcagcacctggtgcatatgaaggtgcaaactacggt
ggaggcaacaactacatgaacaatgcaaccagtgatgattccaccggtaagctggacgag
ttgttaaatgatcttaaagttgatggtgatggcaaagaggatggtgagggcaaagcggat
ggcgctggcctggttaatgaggatctgaaaggagatgatggtcaggatgaattgcttcag
aatgatttcaaagatgaagatgtgtctgatgactatgccaacaaaagacgttaa

DBGET integrated database retrieval system