KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326266
Entry
4326266           CDS       T01015                                 
Name
(RefSeq) hydroxymethylglutaryl-CoA lyase, mitochondrial
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04146  Peroxisome
Module
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4326266
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4326266
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4326266
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     4326266
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-GeneID: 4326266
NCBI-ProteinID: XP_015616974
UniProt: B9EV50 Q0JNR8
LinkDB
Position
1:complement(9268631..9272914)
AA seq 459 aa
MLASKLWSRLASPSSPASPRALSSSSSAAAAARYLLPSSGMPAQERSPGHPSGGDARPGA
GLGLAETGCGAAGAPRPLPLPCSSSSDNPAEENPCTRQIYQRQLMPHRFKLFLGEKRHFT
YANGASLNPQNYRYFSSSSGQQSIGIGNKIIHDLPRSVKIVEVGPRDGLQNEKNIVPTHV
KIELIQRLATSGLSVVEATSFVSPKWVPQLADAKDVMDVVRNIEGVSLPVLTPNLKGFEA
AVAAGAKEVAVFASASEAFSKSNINCTIKESLARYKDVALAAKELKIPMRGYVSCVVGCP
VEGYVPPSNVAHVAKELYDMGCYEVSLGDTIGVGTPGTVVPMLEAVMFFVPKEKLAVHFH
DTYGQSLSNILISLQMGVSVVDSSVAGLGGCPYAKGASGNVATEDVVYMLNGLGISTNVD
LGKVMAAGEFICNHLGRQSGSKAAIALGSKVATANASKL
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgctggcgtcaaagctctggtcgaggctcgcgtcgccgtcttcccccgcctcgccgcgc
gccctttcttcttcttcatcggcggcggcggcggcgaggtacctactgccgagctctggg
atgccggcccaagaaaggtcgccgggtcaccccagtggcggcgacgcgcggcccggtgcg
gggctcgggctcgccgagactgggtgtggcgcggccggtgcgccgcgaccgctgccgctg
ccgtgctcttcttcgtcggacaatcccgcggaagagaatccttgcacaagacagatatac
caaagacagctaatgccgcatcggttcaagttatttttgggggagaaacgtcattttaca
tatgcaaatggtgcttcactgaatccgcagaactacagatatttttcatcttcttctggc
caacagagtataggaattggtaacaagattatacatgaccttccaagaagtgtgaaaatt
gtggaagttgggccacgagatgggctacagaatgagaagaacatagttccaacacatgta
aagattgaactcatacagagactggcaacctctggattatcggttgttgaggcaactagt
tttgtctctccaaaatgggtaccacagctagctgatgctaaggatgtgatggatgtagtc
cggaatattgaaggtgtaagccttcctgtattgacaccaaaccttaagggatttgaggca
gctgttgcagcaggtgcaaaagaagttgcagtatttgcgtcagcttctgaagcattttcc
aagtcaaacataaactgtaccattaaagagagccttgctcgctataaagatgttgctctt
gcagcaaaagagctaaaaatccccatgcgagggtatgtttcttgtgtggttggatgccca
gtagaaggatatgtgccaccgtcaaatgtagctcatgtggctaaagagctttatgacatg
ggctgctacgaggtttcacttggtgatacaataggcgttggtaccccaggcaccgttgtt
ccaatgcttgaggctgttatgttctttgttccaaaggagaagcttgctgtccatttccac
gatacctacggccaatcgctttcaaatatcctcatctctctccagatgggtgtgagcgtt
gtggactcttccgtagcgggcctcggagggtgcccatacgcgaaaggtgcatcgggcaat
gtggcgacggaggacgtggtgtacatgctgaacgggctggggatcagcaccaatgtcgac
ctgggcaaggtgatggccgccggcgagttcatctgcaaccatctggggcgccagtctggg
tccaaggcagctatcgctttgggaagcaaggttgctactgccaacgcatccaaactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349718
Entry
4349718           CDS       T01015                                 
Name
(RefSeq) hydroxymethylglutaryl-CoA lyase, mitochondrial
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04146  Peroxisome
Module
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4349718
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4349718
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4349718
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     4349718
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-GeneID: 4349718
NCBI-ProteinID: XP_015617074
UniProt: Q2RAU5 A0A8J8XJS9
LinkDB
Position
11:1714871..1718573
AA seq 387 aa
MSSLEEPLGLGDLPKLSINRLERFSPNACRASADDRSTSNYKHHNGGNNQTIFHSSSHSW
HMQGQYTDSSCNGVDMEFRALPRKVLWELPRFVKIVEVGPRDGLQNEKSTVPASVKIELI
HKLVASGLSVVEATSFVSPKWVPQLADAKDVLQGIRHVPDVRFPVLTPNLRGFEAALAAG
AKEVAVFASASESFSKSNLNCTIKESLVRYRDVVTSAKKHGMRIRGYVSCVVGCPVEGTI
HPSKVAYVAKELYDMGCSEISLGDTIGVGTPGSILAMLEAVMSFVPVDKLAVHFHDTYGQ
ALANILVSLQLGINIVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGIETNVDLNKLM
DAGDYISKHLGRQSGSKTTTALRKLTT
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgtcgagcctcgaggagccgctcggtcttggggaccttccaaagttgagtattaacaga
cttgaaaggttctctccaaatgcttgcagagcaagtgctgatgaccgtagcaccagcaat
tacaagcatcacaatggtggcaacaatcagacgatctttcacagcagttctcattcatgg
catatgcaaggccaatatactgattcctcctgcaatggagtggatatggagttcagagct
cttccacggaaggttttgtgggagcttccaaggtttgtgaagatagttgaagtcggacca
cgggatggtctgcaaaatgagaagagtactgtaccagcttctgtaaagattgaactgata
cacaaattggtggcttctggtctatcagtagttgaagccacaagttttgtttccccaaaa
tgggtgccgcagctagctgatgcaaaggatgtccttcaagggattaggcatgtgccagat
gtgcggtttcctgtgttaactcctaacctcagaggatttgaggctgctcttgcagctggt
gcaaaagaagttgcagtcttcgcatctgcctctgaatccttttctaagtcaaaccttaat
tgtaccatcaaggaaagccttgttcggtaccgtgatgttgtaacttctgccaagaaacat
ggaatgcgaatccgtgggtatgtttcatgtgtggttggttgccctgttgaaggcacaatt
catccatcaaaggtagcatacgtagctaaggagctttatgacatgggttgctcggagatt
tcacttggagacacgattggtgttggtacaccaggtagcatacttgctatgcttgaagct
gtaatgtcttttgttccagtggacaagctcgccgtccattttcatgacacatacggccaa
gcccttgccaacatactggtctctctccaactggggatcaacatagtggactcatcagtg
tcaggactgggaggctgcccatatgcaaagggcgccaccggcaatgtcgcgacggaggac
gttgtgtacatgctccatggactggggatagagaccaatgttgacctcaacaagctcatg
gatgctggagattacatctccaagcatctgggaaggcagtcaggctccaagaccaccact
gctctccgcaagctaaccacttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351434
Entry
4351434           CDS       T01015                                 
Name
(RefSeq) hydroxymethylglutaryl-CoA lyase, mitochondrial isoform X1
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00280  Valine, leucine and isoleucine degradation
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa04146  Peroxisome
Module
osa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4351434
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4351434
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4351434
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     4351434
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-GeneID: 4351434
NCBI-ProteinID: XP_015619970
UniProt: A0A8J8Y1F4 Q2QY32
LinkDB
Position
12:1671305..1675164
AA seq 387 aa
MSSLEEPLGLGDLPKLSINRLERFSPSACRASVDDSNTNNYKHRNGGNNQTIFHSSAHSW
HMQGQYTDSSCNGVDMEFRALPRKVLWDLPRFVKIVEVGPRDGLQNEKNTVPTSVKIELI
HKLVASGLSVVEATSFVSPKWVPQLADAKDVVEGIKHVPDVRFPVLTPNLRGFEAAVAAG
AKEVAVFASASESFSKSNLNCTIKESLVRYHDVVTSAKKHGIRIRGYVSCVVGCPVEGTI
HPSKVAYVAKELYDMGCSEISLGDTIGVGTPGSVLAMLEAVMSFVPVDKIAVHFHDTYGQ
ALANILVSLQLGINIVDSSVSGLGGCPYAKGATGNVATEDVVYMLHGLGIETNVDLNKLM
DAGDYISKHLGRQSGSKTTTALRKLTT
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgtcaagcctcgaggagccacttggtcttggggacctgccaaagttgagtattaacaga
cttgaaaggttctctccaagtgcctgcagagcaagtgttgatgacagcaacaccaacaat
tacaagcatcgcaatggtggcaacaatcagacgatctttcacagcagtgctcattcatgg
catatgcaaggccaatatactgattcatcctgcaatggggtggatatggagttcagagct
cttccacggaaggttttatgggaccttccaaggtttgtgaagatagttgaagttggacca
cgggacggtctgcaaaatgagaagaatactgtacccacatctgtaaagattgaactgata
cacaaattggtggcttctggtctatcagtagttgaagccacaagttttgtgtccccaaaa
tgggtgccacagctagcagatgcaaaggatgtggttgaagggattaagcatgtgccagat
gtgcggtttccagtgttaactcctaacctcagaggatttgaggctgctgttgcagctggt
gcaaaagaagttgcagttttcgcatctgcctctgaatccttttctaagtcaaaccttaat
tgtaccatcaaggaaagccttgttcggtaccatgatgttgtaacttctgccaagaaacat
ggaatacgaatccgtgggtatgtttcatgtgtggttggttgccctgttgaaggcacaatt
catccatcaaaggtagcatatgtagctaaggagctttatgacatgggttgctcggagatc
tcactcggagacacgattggtgttggtacaccaggtagcgtacttgctatgcttgaagct
gtaatgtcttttgttccagtggacaagatcgccgtccatttccatgacacatacggccaa
gcccttgccaacatactggtctctctccaactggggatcaacatagtggactcatcagtg
tcaggactgggaggctgcccatatgcaaagggcgccaccggcaatgtcgcgacggaggac
gttgtgtacatgctccatggactggggatagagaccaatgttgacctcaacaagctcatg
gatgctggagattacatctccaagcatctgggaaggcagtcaggctccaagaccaccact
gctctccgcaagctaaccacttaa

DBGET integrated database retrieval system