KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326288
Entry
4326288           CDS       T01015                                 
Name
(RefSeq) thiamine pyrophosphokinase 2 isoform X1
  KO
K00949  thiamine pyrophosphokinase [EC:2.7.6.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00897  Thiamine biosynthesis, plants, AIR (+ NAD+) => TMP/thiamine/TPP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4326288
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.2  thiamine diphosphokinase
     4326288
SSDB
Motif
Pfam: TPK_catalytic TPK_B1_binding
Other DBs
NCBI-GeneID: 4326288
NCBI-ProteinID: XP_015621862
UniProt: Q0JMW0
LinkDB
Position
1:complement(14392148..14398609)
AA seq 267 aa
MLGRAIRSMEVMVHSSTFLLPKLHQPANSPAKKYALVVLNQNLPRFVPRLWTHAKLRICA
DGGANRIFDEMFQMTNDPDYESTRKRYIPEIIEGDMDSIRPEVKQFYSSQGSKISDKSHN
QETTDLHKCISRIHRCTPDHEKTNLCVLVTGALGGRFDHEAANINILYLFSDMRIVLLSD
DCLIRLLPKTHKHEIYIESSVEGPHCGLFPVGAPSGSTTTTGLKWNLSEAKMRFGSMIST
SNIVHAEKVTVQSDADLLWTISLRNLT
NT seq 804 nt   +upstreamnt  +downstreamnt
atgttggggcgcgcaatacgcagtatggaggttatggtgcattcttcaaccttccttctt
ccaaagttgcatcagcctgccaactctccagcaaagaagtatgctctagttgttcttaat
cagaaccttccacgattcgtgccccgcctgtggactcatgcaaagctaagaatctgtgct
gatggaggtgccaatcgtatattcgatgagatgtttcagatgactaatgatccagactat
gaaagcacccgaaaaaggtatattccagaaataattgagggagatatggattctataagg
ccagaagtgaaacagttctactctagccagggatctaaaatttctgataaatcacataac
caagagacaacagatttgcacaagtgtatttctcggatccatcgttgtacacctgatcat
gaaaaaacaaatctttgtgttcttgtgactggagcacttggtggaaggtttgatcatgag
gctgctaatatcaacattctgtatttgttctcggacatgaggattgttcttctatcagat
gactgcttgattcggcttcttcccaaaacacacaagcatgagatctatattgagtcatct
gttgaagggccacattgtggactttttcctgttggagcaccatctggaagcactacaacc
actggcctgaagtggaacttgagtgaagcgaagatgagatttgggagtatgataagcaca
tccaacattgttcacgcagaaaaggttactgtacaatccgatgcagatcttctctggaca
atttccctccgaaatctgacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326818
Entry
4326818           CDS       T01015                                 
Name
(RefSeq) thiamine pyrophosphokinase 1 isoform X1
  KO
K00949  thiamine pyrophosphokinase [EC:2.7.6.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00897  Thiamine biosynthesis, plants, AIR (+ NAD+) => TMP/thiamine/TPP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4326818
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.2  thiamine diphosphokinase
     4326818
SSDB
Motif
Pfam: TPK_catalytic TPK_B1_binding DUF5877
Other DBs
NCBI-GeneID: 4326818
NCBI-ProteinID: XP_015621775
UniProt: Q5JK24
LinkDB
Position
1:complement(40868708..40871911)
AA seq 264 aa
MPLPTMTHSSSFLRLPATSSPHPPPADDASAAYAVVVLNQRLPRFAPLLWDRARLRVCAD
GGANRVFDGMPELLPAEDPDQVRMRYKPDVIKGDMDSIRPEVKEYYSNLGAEIVDESHDQ
DTTDLHKCVSFITRNPPGSEESNLYILVLGALGGRFDHEMGNINVLYRFSNIRIVLLSDD
CSIFLLPKTHSHEIHIERSIEGPHCGLIPMGSPSASTTTTGLRWNLDNTSMSYGGLISTS
NIVEEETVRITSDSDLIWTISLRN
NT seq 795 nt   +upstreamnt  +downstreamnt
atgccgctgccgacgatgacccactcctcctccttcctccgcctccccgccacctcctcg
ccgcacccgccgcccgcggatgatgcttccgcggcctacgccgtcgtcgtcctcaaccag
cgcctgccccgcttcgcccccctcctctgggaccgcgcgcggctgcgggtgtgcgccgac
gggggtgccaaccgggtgttcgatggaatgccggagctgctgcccgccgaggacccggac
caggtccgcatgaggtacaagccagatgtgatcaaaggggatatggactcaataaggcca
gaagtgaaggaatattattccaatctgggtgccgaaatagttgatgaatcacatgatcag
gacaccactgacctgcataaatgtgtatcatttatcaccagaaatccacctggctctgaa
gagtctaatctgtatattcttgttcttggtgcacttggaggaaggttcgatcatgagatg
gggaacatcaacgtgttatatcgcttctcaaacatcaggattgtcctcctgtctgatgac
tgctcaatctttctgctcccaaagacgcacagccacgagatccatatcgagcgatcaatc
gagggtcctcattgtggattgattccaatgggttcaccatcggctagcactaccaccaca
gggctccggtggaatttagataatactagcatgagctacggtggactgataagcacatct
aacatcgtggaagaggaaacagttaggatcacttcagattctgatctgatttggacaata
tcactccggaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338566
Entry
4338566           CDS       T01015                                 
Name
(RefSeq) thiamine pyrophosphokinase 3
  KO
K00949  thiamine pyrophosphokinase [EC:2.7.6.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00730  Thiamine metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00897  Thiamine biosynthesis, plants, AIR (+ NAD+) => TMP/thiamine/TPP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    4338566
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.2  thiamine diphosphokinase
     4338566
SSDB
Motif
Pfam: TPK_catalytic TPK_B1_binding
Other DBs
NCBI-GeneID: 4338566
NCBI-ProteinID: XP_015637762
UniProt: Q60DX1
LinkDB
Position
5:complement(17644846..17649678)
AA seq 267 aa
MAPRPAMSHSSAFLLPSPSAAAAGADADGAAYALLVLNQRLPRFAPRLWDRAQVRVCADG
GANRVFDGMPELFPGQDPDEVRRRYKPDVIKGDLDSVRPEVKEYYSNMGTQIVDESHDQD
TTDLHKCVAFITENSAIPNKSNLCIFALGALGGRFDHEMGNINVLHLFPNNRIILLSDDC
LIFLLPRTHTHNIHIERSIEGPHCGLIPIGAPSATTTTTGLQWNLDNTSMSFGGLISTSN
IVREESTVVTITSDSDLIWTISLRHHS
NT seq 804 nt   +upstreamnt  +downstreamnt
atggccccgaggccggccatgtcccactcctccgccttcctgctgccctcgccgtccgcg
gcggcggcgggcgccgacgccgacggcgccgcctacgcgctcctcgtcctcaaccagcgc
ctgccccgcttcgcgccccgcctctgggaccgcgcgcaggtgcgggtgtgcgcggacggc
ggcgccaaccgggtgttcgacggcatgccggagctgtttcctggacaggaccccgacgag
gttcgccgcagatacaaaccagatgtaatcaaaggagatctggactcagttcgaccagaa
gtgaaggaatattattccaatatgggtactcaaatagtcgatgagtcacatgatcaggac
accaccgatttacacaaatgtgtagcttttatcactgagaattcggccatccccaacaaa
tctaatctgtgtatctttgctcttggggcccttgggggaaggtttgaccacgagatggga
aacatcaacgtacttcatctcttcccaaacaacaggatcatactcctatcggatgattgc
ttgatctttctgctgccaagaacacacactcataacatccatattgaacggtctattgag
gggccccactgtggattgattcccatcggcgcgccttcggccaccaccacaaccactggg
cttcaatggaatttagataataccagcatgagctttggtggacttattagcacatcaaac
attgtgagagaggagagtactgttgttacgatcacttcagattctgacctgatttggaca
atatcgctccggcaccactcttga

DBGET integrated database retrieval system