KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326312
Entry
4326312           CDS       T01015                                 
Name
(RefSeq) glyoxylate/succinic semialdehyde reductase 2, chloroplastic
  KO
K18121  glyoxylate/succinic semialdehyde reductase [EC:1.1.1.79 1.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4326312
   00650 Butanoate metabolism
    4326312
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     4326312
    1.1.1.-
     4326312
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored ApbA Shikimate_DH 2-Hacid_dh_C 3HCDH_N
Other DBs
NCBI-GeneID: 4326312
NCBI-ProteinID: XP_015615472
UniProt: Q656T5 Q0JLS8
LinkDB
Position
1:complement(22088211..22091079)
AA seq 341 aa
MAAMAAASLLCARAAAAAPTLRLRGGGRGARLVFSCSASSSSPSGEGGFSGKVGFLGLGI
MGAPMASNLINAGCDVTVWNRTRSKCDPLLSLGAKYEPSPADVASSCDVTFAMLADPESA
VEVACGANGAAQGMAPGKGYVDVSTVDAATSKLIGKHITSTGASFLEAPVSGSKKPAEDG
LLIFLTAGDESLYNRVASLLDVMGKSRFFLGDVGKGADMKLVVNMVMGSMMVSFSEGLLL
SEKVGLDPNTLVEVISQGAISAPMFSLKGPSMVKAAYPTAFPLKHQQKDLRLALALAESV
SQSIPTVAAANELYKVAKSLGLADQDFSAVIEALKAKEQSK
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggcggcgatggcggcggcctccctcctgtgcgcgagggcggcggcggcggcgcccacg
ctgcgcctacgcggcggaggcaggggagcacgcctcgtcttctcctgctccgcctcctcg
tcgtcgccgtccggggaaggagggttcagtgggaaggtggggttcctcggcctcgggatc
atgggcgcacccatggcctccaacctcatcaacgccgggtgcgatgtcacggtgtggaac
aggaccaggagcaagtgcgacccgctcctcagcctcggcgccaagtacgagccttcaccg
gccgatgttgcttcgtcttgcgatgtgaccttcgcgatgcttgctgatccggagagcgcg
gttgaggttgcatgcggggccaatggagctgcacaggggatggccccagggaaagggtat
gtggatgtgtcgacggttgacgctgctacatccaagctgattggcaagcacattacaagt
actggggcatctttccttgaggctccagtttcaggctcaaaaaagccagcagaagatggg
ctgctcatctttcttaccgcaggtgatgagtccttgtacaatagagtggcatccctcctt
gatgttatgggcaagtcaagatttttcctcggtgacgttggcaaaggtgcagacatgaag
ctcgttgttaatatggtcatggggagcatgatggtttcgttttcagaaggactgctcctg
agcgaaaaagttggcctagaccccaatactcttgtcgaggttatttcacaaggtgctatc
agtgctcccatgttctccctcaagggcccttccatggttaaagctgcataccctactgct
tttcctctgaagcatcagcagaaggatttgaggctcgcattggccctggcagaatcggtg
tcccagtctattcctacagtcgcagctgcaaacgagctgtacaaggtcgcgaaatcgctt
gggcttgcagaccaggacttctctgctgtaatcgaggcgctgaaggcaaaggagcagagc
aagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329690
Entry
4329690           CDS       T01015                                 
Name
(RefSeq) glyoxylate/succinic semialdehyde reductase 1
  KO
K18121  glyoxylate/succinic semialdehyde reductase [EC:1.1.1.79 1.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00630  Glyoxylate and dicarboxylate metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4329690
   00650 Butanoate metabolism
    4329690
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     4329690
    1.1.1.-
     4329690
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 Sacchrp_dh_NADP Shikimate_DH ApbA F420_oxidored 3HCDH_N 2-Hacid_dh_C NAD_Gly3P_dh_N
Other DBs
NCBI-GeneID: 4329690
NCBI-ProteinID: XP_015623177
UniProt: Q84VC8 Q6ZGB8
LinkDB
Position
2:21344267..21348527
AA seq 293 aa
MEVGFLGLGIMGKAMAANLLRHGFRVTVWNRTLSKCQELVALGAAVGETPAAVVAKCRYT
IAMLSDPSAALSVVFDKDGVLEQIGEGKGYVDMSTVDAATSCKISEAIKQKGGAFVEAPV
SGSKKPAEDGQLVILAAGDKVLYDDMVPAFDVLGKKSFFLGEIGNGAKMKLVVNMIMGSM
MNALSEGLSLADNSGLSPQTLLDVLDLGAIANPMFKLKGPSMLQGSYNPAFPLKHQQKDM
RLALALGDENAVSMPVAAASNEAFKKARSLGLGDLDFSAVYEVLKGAGGSGKA
NT seq 882 nt   +upstreamnt  +downstreamnt
atggaggtggggttcctggggctgggcatcatggggaaggcaatggcggccaacctcctc
cgccacggcttccgcgtcaccgtctggaaccggactctctccaagtgccaggagctcgtc
gcgctgggcgccgccgtgggggagacgccggcggccgtcgtcgccaagtgcagatacacc
atcgccatgctctccgaccccagcgccgcgctatctgttgtattcgacaaggacggcgtg
ctcgagcagattggggaagggaagggttatgtggacatgtccactgttgatgccgccact
tcttgcaagataagcgaggctataaaacaaaaaggtggggcttttgttgaagctccagtt
tcaggaagcaaaaagccagctgaagatggccaattggtcattcttgctgcaggggacaag
gtattgtatgatgatatggtccctgcatttgatgtacttgggaaaaagtcgttctttttg
ggagagattggaaatggagcaaagatgaaactggtggtcaacatgatcatgggaagtatg
atgaatgctttgtctgagggactctctctggctgataacagtggtttgagcccccagaca
cttcttgatgtcctggaccttggcgccatcgcgaatccaatgttcaagctgaaagggccc
tcgatgctgcaaggcagctacaaccctgcatttcccctgaaacaccagcagaaggatatg
aggttggcacttgccctaggagacgagaacgctgtctccatgccagtggcagctgcttcc
aacgaggcgttcaagaaagcaagaagcttgggactaggggacctggatttctcagcggtt
tacgaggtactgaagggcgcaggtggctcaggcaaggcgtga

DBGET integrated database retrieval system