KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326350
Entry
4326350           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4326350 isoform X1
  KO
K02914  large subunit ribosomal protein L34
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326350
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4326350
  Bacteria
    4326350
SSDB
Motif
Pfam: Ribosomal_L34
Other DBs
NCBI-GeneID: 4326350
NCBI-ProteinID: XP_015625902
UniProt: A0A8J8XPQ9 Q8LR04
LinkDB
Position
1:21933267..21936661
AA seq 146 aa
MSSAKTLARAGSSLLGRLLASPSPLRAGLPPPSLLSRIQPLVPPPPPPQPRPETTVEAYE
AQAVARLSSLPGEISFPCGLPSLRFIIEDGKDPVANEPLELLPKRTYQPSTIKRKRTHGF
LTRKSTKGGRKVIARRIAKGRHRISV
NT seq 441 nt   +upstreamnt  +downstreamnt
atgtcgtcggcgaaaaccctagcgcgggcgggctcctccctcctcggccgcctcctcgcg
tccccgtctccccttcgcgcggggctgcctccgccgtcgctgctctccaggatccagccg
ctcgtccccccgccgccgccgccgcagccgcggccggagacgacggtggaggcctacgag
gcgcaggcggtggcgaggctgagctcgctcccaggagagatctccttcccctgcggcctc
ccctcgctccggttcatcatcgaagacggaaaggatcctgttgctaatgaacccctggag
ctacttccaaaaagaacttatcagcccagtaccatcaagcggaaaagaacccatgggttt
cttacacgaaaatcaaccaaaggtgggcgtaaggtgattgcgcgcaggattgccaagggc
aggcacagaatttcagtgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327541
Entry
4327541           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L34, chloroplastic
  KO
K02914  large subunit ribosomal protein L34
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327541
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327541
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4327541
  Bacteria
    4327541
SSDB
Motif
Pfam: Ribosomal_L34
Other DBs
NCBI-GeneID: 4327541
NCBI-ProteinID: XP_015614884
UniProt: A2ZYS3
LinkDB
Position
1:complement(34133813..34135655)
AA seq 167 aa
MALALVSPMAALSLHSGRISAAAIGGGLRSRRASPMGAAATPFLRSSFVSSSSTSSASAS
PAALSAAVSASLTFTSASSFAGSSLGIEFSYNRVTTGRSRILQIRAGKAALCMTKRNRSR
KSLARTHGFRRRMRTTAGRKVLKRRRAKGRRVLCTKTNSPTGKKRMF
NT seq 504 nt   +upstreamnt  +downstreamnt
atggcgctcgccctcgtctcgccaatggcggctctctcactccactccgggaggatctca
gcggcggctatcggcggcggcctccgctctcgcagggcatccccgatgggcgccgccgcc
accccgttcctccggagctccttcgtctcctcctcctccacgtcatccgcctccgcctcc
cccgccgcgctctctgccgcggtctcggcgtcgctgaccttcacctctgcctcctcattt
gctggttcatctttgggaattgaattcagctacaacagagttacaacaggaagatcccgg
attctgcagattagggctggaaaggctgctctgtgcatgaccaagagaaatagatctagg
aagtcgcttgcccgtacacatggttttcgcagacggatgaggactactgccggaagaaag
gtcctgaagcgcagacgcgccaaaggaagaagggttctctgcacaaagacgaactccccc
actgggaagaaacgaatgttctga

DBGET integrated database retrieval system