KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326375
Entry
4326375           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 2 member C4
  KO
K12355  coniferyl-aldehyde dehydrogenase [EC:1.2.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4326375
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.68  coniferyl-aldehyde dehydrogenase
     4326375
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 4326375
NCBI-ProteinID: XP_015618943
UniProt: Q9LRE9 Q7F6Y3
LinkDB
Position
1:23097226..23106223
AA seq 502 aa
MAAANGGDSKGFEVPKLEIKFTKLFINGRFVDAVSGKTFETRDPRTGEVIAKIAEGDKAD
IDLAVKAAREAFDHGPWPRMSGFARGRILHKFADLVEQHVEELAALDTVDAGKLFAMGKL
VDIPGGANLLRYYAGAADKVHGETLKMARPCHGYTLKEPVGVVGHIVPWNYPTTMFFFKA
SPALAAGCTMVVKPAEQTPLSALFYAHLAKLAGVPDGVLNVVPGFGPTAGAAISSHMDID
KVSFTGSTEVGRLVMEAAAKSNLKPVSLELGGKSPVIVFDDADLDTAVNLVHMASYTNKG
EICVAGSRIYVQEGIYDAFVKKATEMAKKSVVGDPFNPRVHQGPQIDKEQYEKILKYIDI
GKREGATLVTGGKPCGENGYYIEPTIFTDVKEEMSIAQEEIFGPVMALMKFKTVEEAIQK
ANSTRYGLAAGIVTKNIDVANTVSRSIRAGAIWINCYLGFDPDVPFGGYKMSGFGKDMGM
DALEKYLHTKAVVTPLYNTPWL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcggcggcgaacggcggcgacagcaaggggttcgaggtgccgaagctggagatcaag
ttcaccaagctcttcatcaatggccgcttcgtcgacgccgtctccggcaagacattcgaa
acccgtgacccgcgcaccggcgaggtcatcgccaagatcgccgaaggagacaaggccgac
atcgacctcgccgtgaaggccgccagggaggccttcgaccatggcccctggccaagaatg
tccggctttgcgaggggaaggatcctgcacaagttcgcggacctggtggagcagcacgtg
gaggagctggcggcgctggacacggtggacgccggcaagctgttcgcgatggggaagctc
gtcgacatccccggcggcgcgaacctgctccggtactacgccggcgcggcggacaaggtg
cacggcgagacgctcaagatggcgcggccatgccacgggtacacgctcaaggagcccgtc
ggcgtcgtcggccacatcgtgccgtggaactaccccaccaccatgttcttcttcaaggcc
agcccggcgctcgccgccggctgcaccatggtcgtcaagcccgccgagcagacccccctc
tccgcgctcttctacgcccacctcgccaagcttgccggcgtccccgacggcgtgctcaac
gtcgtccccggcttcggccccaccgccggcgccgctatctcctcccacatggacattgac
aaggtgagcttcaccggctcgacggaggtcggccggctggtgatggaggcggcggcgaag
agcaacctgaagcccgtctcgctcgagctgggtggcaagtctccggtcatcgtgttcgac
gacgccgacctcgacacggccgtgaacctggtccacatggcctcctacaccaacaagggt
gagatctgcgtcgccggctcgcgaatctatgtccaggaggggatctacgatgcgttcgtg
aagaaggcgaccgagatggccaagaaatcggtggtcggagatccgttcaacccgcgagtt
catcaaggccctcagattgacaaggagcaatacgagaagatcctcaagtacatcgacatc
ggtaagcgcgaaggcgcgacgttggtcaccggagggaagccctgcggcgaaaacgggtac
tacatcgagcccaccatcttcacggacgtcaaggaagaaatgtcgatcgcgcaagaggaa
atcttcgggccggtgatggccctcatgaaattcaagacggttgaggaggcgatccagaag
gcgaacagcacccggtacggcctggctgccggcatagtcaccaagaacatcgacgtcgcg
aacacggtttcgcggtcgatccgggcaggggcaatctggatcaattgctacctcggcttc
gaccccgacgtgccgttcggggggtacaagatgagcggcttcggcaaggacatgggcatg
gacgcccttgagaagtacctccacaccaaggcggtggtcacccctctctacaacacccct
tggctatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326376
Entry
4326376           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 2 member C4
  KO
K12355  coniferyl-aldehyde dehydrogenase [EC:1.2.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4326376
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.68  coniferyl-aldehyde dehydrogenase
     4326376
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-GeneID: 4326376
NCBI-ProteinID: XP_015621533
UniProt: A0A0N7KD90 Q94JC6
LinkDB
Position
1:23113635..23119705
AA seq 507 aa
MGSTGDCGNGKAAAGGGGLVVPEIKFTKLFINGEFVDAASGKTFKTRDPRTGDVLAHIAE
ADKADVDLAVKAAREAFEHGKWPRMSGYERSRVMNKLADLVEQHADELAALDGADAGKLL
TLGKIIDMPAAAQMMRYYAGAADKIHGESLRVAGKYQGYTLREPIGVVGVIIPWNFPTMM
FFLKVSPALAAGCTIVVKPAEQTPLSALYYAHLAKLAGVPDGVINVVPGFGPTAGAALSS
HMDVDSVAFTGSAEIGRAIMESAARSNLKNVSLELGGKSPMIVFDDADVDMAVSLSSLAV
FFNKGEICVAGSRVYVQEGIYDEFVKKAVEAAKNWKVGDPFDAATNMGPQVDKVQFERVL
KYIEIGKNEGATLLTGGKPTGDKGYYIEPTIFVDVKEEMTIAQEEIFGPVMSLMKFKTVE
EAIEKANCTKYGLAAGIVTKNLNIANMVSRSVRAGTVWVNCYFAFDPDAPFGGYKMSGFG
RDQGMVAMDKYLQVKTVITAVPDSPWY
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggggagcaccggcgactgcggcaatggaaaggcggccgccggcggcggcgggttggtg
gtgccggagatcaagttcaccaagctcttcatcaacggcgagttcgtcgacgccgcctcg
ggcaagacattcaagacaagggacccacgaacaggcgatgtcctggcccacatcgcagag
gcagacaaggctgatgtggacctcgccgtcaaggccgcgagagaggccttcgagcacggc
aagtggccccgcatgtcaggctatgagaggagcagggtgatgaacaagctggccgacctg
gtggagcagcacgccgacgagctggcggcgctggacggcgccgacgccgggaagctgctg
acgctgggcaagatcatcgacatgcccgccgcggcgcagatgatgcggtactacgccggc
gcggccgacaagatccacggcgagtcccttcgggtggccggcaagtaccaggggtacacc
ctcagggagcccatcggcgtcgtcggcgtcatcatcccctggaacttccccaccatgatg
ttcttcctcaaggtcagccccgccctcgccgccggctgcaccatcgtcgtcaagcccgcc
gagcagacgcccctctccgctctgtactacgctcacctcgccaagctggctggagttccg
gatggagtgatcaacgtcgtcccgggattcgggccgacagccggtgcggcactctcctcc
cacatggacgtcgacagtgttgctttcactggctctgctgaaatcggccgtgccatcatg
gagtcggcggcgcggagcaacctgaagaatgtgtctcttgagctcggcggcaagtctccg
atgatagtcttcgacgacgccgatgtcgacatggctgtcagtctgtcatcccttgcagtt
ttcttcaacaagggagagatttgcgtggccgggtcacgcgtctatgtccaagaagggatc
tacgatgagtttgtgaagaaggccgtggaggctgccaagaactggaaagttggagaccct
tttgatgctgccaccaatatgggtcctcaggttgacaaggtccaatttgagagggttctc
aagtacattgagatcggcaagaacgagggagcaaccctactcacaggtggcaaacccact
ggtgacaaaggatactacattgagcctaccatatttgtggatgtcaaggaggaaatgacg
attgcgcaagaggagatcttcggcccggtgatgtccctcatgaagttcaagacggtggag
gaggcgatagagaaggccaactgcaccaagtacgggctggctgccggcattgtgaccaag
aacctcaacattgccaacatggtgtcgaggtcagtgcgggccggcacggtgtgggtgaac
tgctacttcgccttcgaccccgacgcgccgttcggcgggtacaagatgagcgggttcggc
cgggaccaagggatggtcgccatggacaagtacctgcaggtcaagaccgtcatcaccgcc
gtcccggactcgccctggtactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341419
Entry
4341419           CDS       T01015                                 
Name
(RefSeq) aldehyde dehydrogenase family 2 member C4
  KO
K12355  coniferyl-aldehyde dehydrogenase [EC:1.2.1.68]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4341419
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.68  coniferyl-aldehyde dehydrogenase
     4341419
SSDB
Motif
Pfam: Aldedh LuxC
Other DBs
NCBI-GeneID: 4341419
NCBI-ProteinID: XP_015641595
UniProt: Q69XE0
LinkDB
Position
6:23286826..23292317
AA seq 526 aa
MASESESNGHHHAGDEARAENSGAGCLHGGDDGGGTPRTTPEIRYTKLFINGRFVDAASG
KTFETRDPRTGDVIARVAEGDKEDVDLAVKAAREAFDHGEWPRMSGSERGRVMAKYAEVV
ERHADELAALESLDAGKPLAAARAVDVGECVGILRYFAGAADKIHGETLKMSRQLQGYTL
REPLGVAGLIVPWNFPAIMFFSKVSPALAAGCTVVVKPAEQTPLSALFLAHLSKQAGVPD
GVINVVTGFGPTAGAAISSHMDVDVVAFTGSTEVGRLIMEASAKSNLKPVALELGGKSPF
IVFDDADLDKAVELAIGGNFFNKGEACVAGSRVFVQEGIYDRFEQKLADTMKSWVVGDPF
DPRVNQGPQVDKAQYERVLGYIEQGKAEGATVLTGGKPCGKKGYYIEPTIFTNVKDDMVI
AREEIFGPVMCLMKFKTVEEAIERANGTRYGLAAGLVTRDIDVANRMARSIRAGVVWVNC
YFAMDRSCPFGGRKMSGFGKDDSMHALDKFLAVKSVVTPVHGSPWF
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggcgagcgagagcgagagcaacggccaccaccacgccggcgacgaggcgcgcgcggag
aacagcggcgcggggtgcctccacggcggcgacgacggcggcgggacgcccaggacgacg
ccggagatcaggtacaccaagctgttcatcaacgggcgcttcgtcgacgcggcctccggt
aagacgttcgagaccagggacccccgcaccggcgacgtgatcgcccgcgtcgccgaaggc
gacaaggaggacgtcgacctggcggtgaaggcggcgagggaagcattcgaccacggcgaa
tggcctcgcatgtcgggatcagagagagggagggtcatggcgaagtacgcggaggtggtg
gagcggcacgcggatgagctggcggcactggagagccttgacgccggcaagccgctcgcc
gccgccagggcggtggacgtcggcgagtgcgtcggcatcctgcgctacttcgccggcgcc
gccgacaagatccacggcgagacgctcaagatgtcgaggcagctccagggttacaccctc
cgcgagcccctcggcgtcgccggcctcatcgtcccctggaacttcccggccatcatgttc
ttctccaaagtctcaccggcgctcgccgccggctgcaccgtcgtcgtcaagcccgccgag
cagacgcccctcagcgccctgttcctcgcccacctatcaaagcaagcaggagtaccggat
ggggtgatcaacgtggtgacaggattcggcccaacagcgggagctgcaatttcatctcac
atggatgttgacgtggtggctttcacgggatctactgaggttggacggcttataatggag
gcctccgcgaagagcaacctgaagccggtggcactcgagctcggcggcaagtcgccgttc
atcgtcttcgacgacgccgacctggacaaggccgtcgagctcgccatcggcgggaacttc
ttcaacaagggagaagcctgcgtcgccgggagccgcgtgttcgtgcaggagggcatctac
gaccggttcgagcagaagctagcggacaccatgaagagctgggtcgtcggcgaccccttc
gatcctcgcgtcaatcaaggaccacaggtggacaaggctcagtatgagagggtgctcggg
tacatcgagcaaggcaaggcagaaggggcaactgttctcacgggagggaagccctgcggt
aagaaagggtactacatcgagcccaccattttcaccaatgtgaaggacgacatggtcatc
gcgagggaggagatcttcggccccgtcatgtgcctgatgaagttcaagacggtggaggag
gcgatcgagagggcgaacgggacgaggtacgggctggcggcggggctggtgacgagggac
atcgacgtggcgaaccggatggcgaggtcgatccgggcaggggtggtgtgggtgaactgc
tacttcgccatggacaggagctgcccgttcggtggccgcaagatgagcgggttcggcaag
gacgacagcatgcacgcgctcgacaagttcctcgccgtcaagtccgtcgtcacccccgtc
catggctccccctggttctga

DBGET integrated database retrieval system