KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326383
Entry
4326383           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L25
  KO
K02897  large subunit ribosomal protein L25
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326383
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326383
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    4326383
SSDB
Motif
Pfam: Ribosomal_TL5_C Ribosomal_L25p
Other DBs
NCBI-GeneID: 4326383
NCBI-ProteinID: XP_015626950
UniProt: A2ZUZ6 Q0JLK3
LinkDB
Position
1:complement(23234794..23237667)
AA seq 271 aa
MAMLLRRPLHTLPILPLLGRHLSSSSAAAEAVTADHHHHHDADLLSPPFDYLPGHPRPDA
KHDELILAVPRASSGRHVAAKERKAGRVPAIVFEQENGQEGGNKRLVSVQSKQIRKLVDH
LGRSFFLSRLFRLQVWSEHAGQGELIESVRVLPRKVHLHAGTDEPLNVTFMRAPSSALLK
IDVPLMFIGEDASPGLRKGAYFNTIKRTVKYLCPADIVPPYIEVDLSELDVGQKLLMRDL
KVHPALRLLQSPEQPICSIIGSRAPDQKKSK
NT seq 816 nt   +upstreamnt  +downstreamnt
atggccatgctgctccggcgacccctccacacccttcccatcctccccctcctcggccgc
cacctctcctcctcctccgccgccgcggaggcggtcaccgcggaccaccaccaccaccac
gacgcggacctcctgtcgccgccgttcgactacctcccgggccacccgcggccggacgcg
aagcacgacgagctcatcctcgccgtgccgcgcgcctcctcggggcggcacgtggcggcc
aaggagcggaaggccgggcgggtgccggccatcgtgttcgagcaggagaacgggcaggag
ggcggcaacaagcggctggtgtccgtgcagtccaagcagatccgcaagctcgtcgaccac
ctcggccgctccttcttcctctcccgcctcttccgcctccaggtctggtccgagcacgcc
ggccagggggagctcatcgagagcgtccgcgtccttccccgcaaggtacacttacatgca
ggaactgatgagcctctgaatgtgacattcatgagagccccttcttcagccctactcaag
atagatgttcctttgatgttcatcggagaggatgcatcgcctggtctcaggaaaggggct
tacttcaacaccataaaacgaactgtcaagtatctgtgccctgctgacatagtgccacca
tacattgaggtggatttaagtgagttggatgtcggacagaaactgttgatgcgtgatctc
aaagttcacccagctctgaggttgcttcagtcaccggaacaacccatctgtagcattata
ggatcaagagcacctgatcagaagaagtcaaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338257
Entry
4338257           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L25
  KO
K02897  large subunit ribosomal protein L25
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4338257
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4338257
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    4338257
SSDB
Motif
Pfam: Ribosomal_TL5_C Ribosomal_L25p
Other DBs
NCBI-GeneID: 4338257
NCBI-ProteinID: XP_015638371
UniProt: Q0DJK3 Q5W6B7
LinkDB
Position
5:10865357..10869240
AA seq 265 aa
MAMLLRRPLRALTLPLLRPHLSTAAAAEVSPADHHPDLLSPPFGYLPGHPRPDAKHDELI
LAVPRASPGRHVAAKERKAGRVPAIVFEQENGQEGGNKRLVSVQSKQIRKLVDHLGRSFF
LSRLFRLQVWSEHAGQGVLIESVRVLPRKVHLHAGTDEPLNVTFMRAPSSALLKIDVPLM
FIGDDASPGLRKGAYFNTIKRTVKYLCPADIVPPYIEVDLSELDVGQKLLMRDLKVHPAL
KLLQSPEQPICSIIGSRAPEQKKSK
NT seq 798 nt   +upstreamnt  +downstreamnt
atggccatgctactccggcgacccctccgggccctcaccctcccgctcctccgcccccac
ctctccaccgccgccgcggcggaggtgtcccccgcggatcaccacccggacctcctgtcg
ccgccgttcggctacctcccgggccacccgcggccggacgcgaagcacgacgagctgatc
ctcgccgtgccgcgggcctccccgggacgccacgtggcggccaaggagcggaaggccggg
cgggtgccggccatcgtgttcgagcaggagaacggccaggaggggggcaacaagcgcctc
gtctccgtccagtcgaagcagatccgcaagctcgtcgaccacctcggccggtccttcttc
ctctcccgcctcttccgcctccaggtctggtccgagcacgccgggcagggggtgctcatc
gagagcgtccgcgtcctgccgcgtaaggtacacttacatgcaggcactgatgagcctctg
aatgtgacattcatgagagccccttcgtcggcactgctcaaaattgatgttcctttgatg
ttcattggggacgatgcgtcacctggtcttaggaaaggagcctacttcaataccataaaa
cgaactgtgaagtatctctgccctgctgacatagtgccaccctacattgaggtggattta
agcgagttggacgtgggccaaaaactgttgatgcgtgatctaaaagtccatccagctctg
aagttacttcagtcaccagaacaacccatctgtagtattatagggtcaagagcacctgaa
cagaagaagtcaaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272292
Entry
9272292           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L25
  KO
K02897  large subunit ribosomal protein L25
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9272292
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9272292
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    9272292
SSDB
Motif
Pfam: Ribosomal_TL5_C Ribosomal_L25p
Other DBs
NCBI-GeneID: 9272292
NCBI-ProteinID: XP_015628038
UniProt: Q10GV3
LinkDB
Position
3:complement(23135336..23140247)
AA seq 239 aa
MALCLRRAAAAAVGEALRRGASTAPWRRAASASYHHTIQALPRETAGPRAAARERRSGRV
PAVLLALAGAGPGEGVAHRKLLTADRKQLGEILKQSPYFLSTPVRLQVRAGERSTAVVHS
GTVLPIKVHRDETTGNILNLVLVEADEGTMLKVNLPVEFKGEDVCPGLKKGGFLQKIRTS
LVYLCPAEHIPPKIEVDLANLDIGDRVSMNDIPVHPSLRLLSKNETMPVCKILASKPVE
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcgctttgcctccgccgcgccgccgccgccgccgtcggagaggcgctccgccgcggc
gcttcgacggcgccgtggaggcgggcggcctcggcgtcgtaccaccacacgatccaggcg
ttgccgcgggagacggccggcccgcgcgcggcggcgcgggagcgccgcagcggccgcgtc
ccggccgtgctactcgccctcgccggcgccggccccggggagggggtggcccaccggaag
ctcctcaccgccgacaggaagcagctcggggagattctgaagcagtccccctacttcctc
tccacccccgtccgcctccaggtccgcgccggcgagcgatccaccgccgtcgtgcactcc
ggcactgtcctccctatcaaggtgcatagagacgaaacaacaggaaatatattgaacttg
gtgctggtggaggcagatgaaggaacaatgctgaaggtgaacttgcctgtagagttcaag
ggggaggacgtctgccctgggttgaagaaaggcggctttttgcagaaaataaggaccagc
ttggtgtatctctgccctgctgagcacatccctccaaaaattgaggtggacctggcaaat
cttgacattggagatagggtatcaatgaatgacatccccgtccatccgtcgttgaggtta
ctgagtaaaaacgagaccatgcctgtctgcaagatcttggcctcgaaaccagttgagtag

DBGET integrated database retrieval system