KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326397
Entry
4326397           CDS       T01015                                 
Name
(RefSeq) protein FIZZY-RELATED 3
  KO
K03364  cell division cycle 20-like protein 1, cofactor of APC complex
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4326397
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4326397
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     4326397
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A NBCH_WD40 Aldo_ket_red Ge1_WD40
Other DBs
NCBI-GeneID: 4326397
NCBI-ProteinID: XP_015632353
UniProt: Q5JME1 Q5JM92
LinkDB
Position
1:42949402..42952718
AA seq 478 aa
MATDASPKPAPPRLNVPPAMAGGLRLDPAVASPARLLLDVPKTPSPSKTTYSDRFIPCRS
SSRLHNFALLDRDRASPSSTTDDAPYSRLLRAEIFGPDSPSPAPSSPNTNLFRFKTDHPS
PKSPFAASAAATAGHYDCTAGSAESSTPRKPPRKVPKTPHKVLDAPSLQDDFYLNLVDWS
SQNTLAVGLGNCVYLWSASNCKVTKLCDLGPRDSVCAVHWTREGSYLAIGTSLGDVQIWD
SSRCKRIRNMGGHQTRTGVLAWSSRILSSGSRDKNILQHDIRVPSDYISKFSGHRSEVCG
LKWSHDDRELASGGNDNQLLVWNQRSQQPILRLTEHTAAVKAIAWSPHQQGLLASGGGTA
DRCIRFWNTVNGNMLNSVDTGSQVCNLAWCKNVNELVSTHGYSQNQIMVWKYPSMSKVAT
LTGHTLRVLYLAMSPDGQTIVTGAGDETLRFWNIFPSMKTQAPVRDIGLWSFSRSHIR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcgacggacgcgtcccccaagccggcgccgccgcgcctcaacgtgccgccggcgatg
gcgggggggctccgcctcgatcccgccgtcgcctccccggcccgcctcctcctcgacgtc
cccaagacgccatccccttccaagaccacgtacagcgaccgcttcatcccctgccgctcc
tcctcccgcctccacaacttcgccctcctcgaccgcgaccgcgcctccccctcctccacc
accgacgacgccccctactcccgcctcctccgcgccgagatcttcggcccggactccccc
tccccggctccctcctcccccaacaccaacctcttccgcttcaagaccgaccacccctcg
cccaaatcgcccttcgccgcctccgccgccgccaccgccggccactacgactgcaccgcc
ggctccgctgaatcctccacgccgcgcaagccgcccaggaaggtccccaagaccccgcac
aaggtcctggacgcgccgtcgctgcaggacgacttctacctcaatcttgtcgactggtcg
tcgcagaacacgctcgccgtcggcctcgggaattgcgtctacctctggtcggcttccaat
tgcaaggtcaccaagctctgcgatttggggcccagggacagcgtctgcgctgtgcactgg
acccgagaaggctcctatcttgccatcggcaccagccttggcgatgtccagatttgggat
agctctcgctgtaaacggattaggaacatgggaggacaccaaacacggactggtgtatta
gcatggagctcccgaatcttgtcctccggtagcagggacaagaacatattgcagcatgac
atccgtgtcccaagtgactatatcagcaagttctcagggcacagatcagaggtctgtgga
ctgaaatggtcgcacgacgaccgtgagcttgcatccggtggaaatgataatcagctgcta
gtatggaaccaacgttcgcagcagccgatattgaggctgacagaacacacagctgcagtt
aaagcaatagcatggtcaccacatcagcaaggcctcctggcatcaggtggtggaaccgct
gataggtgtatcaggttctggaacacggttaatggaaacatgctgaattcagtggacaca
ggcagccaggtttgtaatcttgcctggtgtaaaaatgtaaatgagcttgtgagcactcat
gggtattcccaaaaccaaatcatggtgtggaagtacccatctatgtcaaaggttgctact
ctaactggacacacgctgcgagtgctttaccttgcaatgtcacctgatggacagacaata
gtaacaggagccggggatgaaaccctcagattttggaatatttttccttcaatgaagaca
caggctcctgttcgtgatattgggctctggtcattctcgagaagccacatacggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331448
Entry
4331448           CDS       T01015                                 
Name
(RefSeq) protein FIZZY-RELATED 2
  KO
K03364  cell division cycle 20-like protein 1, cofactor of APC complex
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4331448
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4331448
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     4331448
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A NBCH_WD40
Other DBs
NCBI-GeneID: 4331448
NCBI-ProteinID: XP_015627938
UniProt: Q10SH0 Q0DVM0
LinkDB
Position
3:1327373..1331220
AA seq 523 aa
MDHHHHHLPPPPPRSPMENSASSKPPTPASTPSSRLAAAPSSRVSSAAPHPSPSSSAPTP
ASRTVYSDRFIPSRAGSNLALFDLAPSPSHHDAAAAAASPGAPPPSGSTPASSPYCALLR
AALFGPTTPDRVASSASACSSSSSAGASPVGSPATGNIFRFKAEVPRNAKRALFSDGDDE
GVLFPGVFTTRGTGPRKIPRSPYKVLDAPALQDDFYLNLVDWSSHNILAVGLGNCVYLWN
ACSSKVTKLCDLGVDDNVCSVGWAQRGTHLAVGTNQGKVQVWDATRCKRIRTMESHRMRV
GALAWNSSLLSSGSRDKSILHHDIRAQDDYISRLAGHKSEVCGLKWSYDNRQLASGGNDN
RLYVWNQHSAHPVLKYTEHTAAVKAIAWSPHLHGLLASGGGTADRCIRFWNTTTNMHLNC
VDTGSQVCNLVWSKNVNELVSTHGYSQNQIIVWRYPTMSKLATLTGHTYRVLYLAISPDG
QTIVTGAGDETLRFWNVFPSPKSQSSDSLSSIGATSFVRSYIR
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggatcaccaccaccaccacctgccgccgccgccgccgcggtcgccgatggagaactcc
gcgtcctccaagccgcccaccccggcgtccaccccgtcgtcgcgcctcgccgccgcgccg
tcctcccgcgtctcctccgcggcgccgcacccctccccgtcctcctccgcgcccacgccg
gcctcgcggacggtctacagcgaccgcttcatccccagccgcgccggatccaacctcgcg
ctcttcgacctcgccccgtcgccgtcccaccacgacgccgccgccgccgccgcctccccc
ggcgcgccgcccccctccggatctaccccggcctcgtcgccctactgcgcgctcctccgc
gccgcgctcttcggccccaccacgcccgaccgggtggcgtcgtcggcgtccgcgtgctcc
tcctcctcctccgccggggcgtcgcccgtgggctcacccgccaccggcaacatattcagg
ttcaaggcggaggtgccccggaatgctaagcgcgcccttttctccgacggggacgacgag
ggcgtgctcttccccggggtgttcacgacgaggggcactggccccaggaagatccctagg
tcaccttataaggtgctggatgctcccgcattgcaggatgacttctacctgaaccttgtg
gattggtcttcgcataatatccttgcagttggattggggaattgtgtctacttatggaat
gcatgcagcagcaaggtcaccaagctatgtgatttgggggtggatgacaatgtctgttca
gtgggttgggcacagcgtggcactcaccttgctgtagggacaaaccaaggcaaagttcag
gtatgggatgccactcgttgtaagagaataagaaccatggaaagccatcggatgcgagta
ggtgctcttgcatggaattcatcattgctttcgtcaggcagtcgtgacaagagcatcctt
caccatgatatccgtgcccaggatgattatattagtagacttgctgggcataaatcggag
gtctgtgggctcaagtggtcttatgataaccgtcagcttgcatctggtggtaatgacaac
agactttatgtatggaatcaacactcggcgcacccggtactgaagtatactgagcataca
gcagctgtcaaagctattgcgtggtcacctcatcttcatgggctgcttgcatctggtgga
ggaactgcagatagatgcatacgattttggaataccaccacgaatatgcacttaaattgc
gtcgacacaggcagtcaggtctgtaatcttgtatggtcaaagaatgttaatgagcttgtt
agcactcatggatattctcaaaatcagataattgtttggcgatacccaacaatgtcaaag
ctcgccacattgacaggccatacatatagggtattatatttagccatctccccagatgga
cagactatagtaactggcgctggtgatgaaacgcttcggttttggaacgtgtttccatct
cccaagtcccagagttctgacagcctaagtagcatcggggccacatcatttgttaggagc
tacatccggtga

DBGET integrated database retrieval system