KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326459
Entry
4326459           CDS       T01015                                 
Name
(RefSeq) sphingosine-1-phosphate lyase
  KO
K01634  sphinganine-1-phosphate aldolase [EC:4.1.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00600  Sphingolipid metabolism
osa01100  Metabolic pathways
Module
osa_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    4326459
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.27  sphinganine-1-phosphate aldolase
     4326459
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2
Other DBs
NCBI-GeneID: 4326459
NCBI-ProteinID: XP_015621818
UniProt: Q52RG7
LinkDB
Position
1:35586..41178
AA seq 539 aa
MELAMDFALRLRDAANHHLSRYEPLVLLAAPLLALLAARTLHAAAAAVADRGLRTVLLAL
AMTAIKLLPGVSAYINAEKRKVVDQLQSGGTSTKSTLRTELPTVGLSNQVINDLETLKAR
DVNWQGKCSGTVYIAGSESEGHFALINKAYSMFSHTNPLHQDVFKSVAQLEAEVVAMTAA
LLGIKEKSSGGQICGNMTSGGTESILLAVKTSRDYMRTKKGITKPEMIIAESAHSAYDKA
AQYFNIKVRRVPVNKEFLADVKGFKRCINGNTIMMVGSAPGFPHGLIDPIEELGELASRY
DICLHVDLCLGGFVLPFARKLGYPIPPFDFCVKGVTSISTDVHKYGLAPKGTSIVLYKNH
EIRKHQFVAVTEWTGGLYVSPTIAGSRPGGLIAGAWAAMTSLGLNGYMENTGHIMEVSKK
IQRGIEDIPGLFVIGKPDMTVVAFGSDSVDIFEVNDIMSSKGWHLNALQRPNSLHICVTL
QHTVIYEEFLKDLKDSVDTVKANPGPISGGRAPIYGAAGKMPDRGMVRELLVEFMDASC
NT seq 1620 nt   +upstreamnt  +downstreamnt
atggagctcgccatggattttgcgctccgcctccgcgacgccgccaaccaccacctctcc
cgctacgagcctctcgtgctcctcgccgcgcccctcctcgccctcctcgctgcccgcacc
ctccacgccgccgctgccgccgtcgccgaccgcggtctccgcaccgtcctcctcgctcta
gccatgacagccatcaagttgcttccgggagttagcgcctacatcaacgctgagaagagg
aaggttgttgaccagctgcagtcaggtggcacgtccacaaaaagtactctgcggaccgag
ttgccaactgttgggctttccaaccaagtgataaacgatctcgaaacactgaaagctaga
gatgtaaactggcagggaaaatgctctggcacagtttatattgctgggagtgaatccgaa
ggtcattttgcattgataaacaaggcttactctatgttttcacacaccaacccacttcac
caggacgtattcaagagtgtggcacaattagaggctgaagtagttgcaatgacagctgct
ttgcttggcatcaaagaaaaatcatccggtggacagatttgtggtaatatgacatcgggc
ggaactgaaagcatattattagcagtaaaaacatcacgcgactatatgcgaacaaagaag
ggcattacaaagcctgaaatgataattgccgaatcagcacattctgcatacgataaagct
gctcaatatttcaatattaaagtgcggcgtgtgccagtgaacaaagagtttcttgcagat
gtgaaaggattcaaaaggtgtataaacggaaatacgataatgatggtggggtctgcacca
ggatttcctcatggtttaattgatcctattgaggaacttggggagttggcttcacgatat
gacatttgcttgcatgttgatctctgccttggtggatttgtattgcctttcgctcgtaag
cttgggtaccctattcctccattcgacttctgtgtcaagggagttacatcaatctcaact
gatgttcataagtatggattagccccaaaagggacaagcattgtcctatataaaaatcat
gaaattagaaagcatcaatttgttgctgttactgaatggactggtgggctctatgtttca
cctactattgctggaagtaggcctggtgggttgatagcgggagcttgggctgctatgacg
tctcttggactgaacggttatatggaaaatacaggtcatatcatggaagtgtcgaagaaa
atacaaagagggattgaagatatcccagggttgtttgtgattggaaagccagacatgact
gtcgtggcatttggctcagattcggttgatatatttgaggtgaacgacataatgtcatca
aaaggctggcaccttaatgctctgcagagacccaacagtttacacatttgtgtgacactg
cagcacacggtcatatatgaggaattcctgaaggatctgaaagattcagtggacactgta
aaagcaaatccagggcctattagcggggggcgagctccgatttacggagctgctggcaag
atgccggacagaggcatggtcagggagctgctggtggagttcatggacgcgtcttgctga

DBGET integrated database retrieval system