KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326469
Entry
4326469           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L23A
  KO
K02893  large subunit ribosomal protein L23Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326469
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326469
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4326469
SSDB
Motif
Pfam: Ribosomal_L23eN Ribosomal_L23 SRPRB DUF4666
Other DBs
NCBI-GeneID: 4326469
NCBI-ProteinID: XP_015622490
UniProt: A0A0P0V275 A2ZSV7
LinkDB
Position
1:13896241..13898198
AA seq 152 aa
MAPKAAVKKADGKTQQALKVAKAVKSGSIKRKSKKIRTSVTFHRPKTLKKARDPKYPRVS
APGRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKV
NTLIRPDGKKKAYVKLTPDYDALDVANKIGII
NT seq 459 nt   +upstreamnt  +downstreamnt
atggctcccaaggccgctgtaaagaaggctgatggaaagactcaacaagccttgaaggtt
gccaaggcagtgaagtctgggtcaatcaagagaaagtcaaagaagatccgcacttcggtg
acatttcacagaccaaagaccctgaagaaggcgagagaccctaagtacccaagagtcagt
gcacctggcaggaacaagcttgatcagtaccaaatcctcaagtacccccttacgaccgaa
tctgccatgaagaagattgaagacaacaacacccttgtcttcatcgtcgacctcaaggca
gacaagaagaagatcaaggcagctgtcaagaagatgtatgacatccaggcaaagaaagtt
aacactctgatcaggcctgacggcaagaagaaggcttacgtgaagctcactccagactat
gatgctcttgatgtggccaacaaaattggcatcatttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336307
Entry
4336307           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L23A
  KO
K02893  large subunit ribosomal protein L23Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4336307
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4336307
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4336307
SSDB
Motif
Pfam: Ribosomal_L23eN Ribosomal_L23 SRPRB PTS_IIA
Other DBs
NCBI-GeneID: 4336307
NCBI-ProteinID: XP_015637056
UniProt: Q0JBZ7 A0A0P0WC47
LinkDB
Position
4:complement(25008054..25010043)
AA seq 152 aa
MAPKAAPAKKGDAKAQALKAAKAVKSGTAKKTTKKIRTSVTFHRPKTLKKSRDPKYPRVS
TPGRNKLDQYQILKYPLTTESAMKKIEDNNTLVFIVDLKADKKKIKAAVKKMYDIQAKKV
NTLIRPDGKKKAYVKLTPDYDALDVANKIGII
NT seq 459 nt   +upstreamnt  +downstreamnt
atggctcctaaagctgctcctgccaagaagggtgatgccaaggcccaagccttgaaggca
gccaaggctgttaagtctgggacagccaagaagacgaccaagaagatccgcacatccgtg
acatttcaccgccccaagaccttgaagaagtctagggaccccaagtacccaagagtcagt
acccctgggaggaacaagcttgatcagtaccagatccttaagtatccccttaccactgaa
tccgcaatgaagaagatcgaagacaacaacactctggtcttcattgttgaccttaaggct
gacaagaagaagatcaaggctgctgtcaagaagatgtacgacatccaggcaaagaaagtg
aacactctgatcaggcctgatgggaagaagaaggcttacgtgaagctgacaccagactac
gatgctctcgacgtggccaacaagattggcatcatctaa

DBGET integrated database retrieval system