KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326503
Entry
4326503           CDS       T01015                                 
Name
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4326503
   00592 alpha-Linolenic acid metabolism
    4326503
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     4326503
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     4326503
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4326503
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2
Other DBs
NCBI-GeneID: 4326503
NCBI-ProteinID: XP_015621075
UniProt: A0A8J8XZW7 Q94CN1
LinkDB
Position
1:13887277..13893142
AA seq 727 aa
MAAAAAAKGRTEMEVGADGVAVITICNPPVNSLSIDVLLSLKENYAEALRRNDVKAIVVT
GKGGKFSGGFDISSFGSVQGGKVEQPKVGYISIDIITDTLEAATKPSVAAIDGLALGGGL
EVAMACHARISTPTAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMMLLSKPIKGAEA
HQLGLVDSLVSADDLVNTARRWALDICELKRPWIKSLYKTDKLEPLGEAREILKFARAQA
RRQAANLEHPLVCIDVIEEGIVSGPRAGLWKEANAFQGLLFADTCKNLVHVFFSQRATSK
VPGATDLGLMPRKVTKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGIDRIKAN
LQSRVRKGKMTEERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDLEKYCP
SHCVLATNTSTIDLNLIGEKTRSKDRIVGAHFFSPAHVMPLLEIVRTQHTSPQVVVDLLD
VGKKIKKTPIVVGNCTGFAVNRMFFPYTQSALLFVDLGMDVYKIDRACTKFGMPMGPFRL
ADLVGFGVAAATGMQYLENFPERVYKSMLIPLMMEDKRTGEASRKGFYKYEDKRKATPDP
EIMKYIEKSRSMAGVTPDTELMKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIAS
IFGMGFPPYRGGIMFWADSIGAKYIHDKLEVWAKRYSDIFKPCSYLAERAANGVPLSAPA
KQVKARL
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggccgcggcggcggcggcgaaggggaggacggagatggaggtcggagcggacggcgtc
gccgtcatcaccatctgcaacccgcccgtcaactcgctctccatcgatgtattgctaagc
ttaaaggaaaactatgctgaagctcttcggaggaatgatgtgaaagctattgttgttaca
gggaaaggaggaaaattttctggaggatttgatattagttcctttggtagtgttcagggt
ggcaaagttgaacagccaaaggttggttacatatcaatagatattatcactgatacccta
gaagctgcaacaaagccatcagtggctgcaattgatggtcttgctcttggtggaggattg
gaagttgctatggcatgccatgcacgcatttcaactcccacagctcaattaggacttcca
gaacttcaacttggagttattccaggatttggaggaacacaacgactcccgcgtcttgtt
ggattgacaaaagcacttgaaatgatgctgctatctaagccaattaagggtgcagaggca
caccaattgggtcttgttgattccttggtttctgctgatgatttggttaatactgctcgt
cgttgggctttggatatctgtgaattaaaaaggccatggatcaaaagtctttataagact
gacaaactagaaccacttggtgaggctagggagattctcaagtttgcaagagctcaagct
cgaaggcaggctgccaatcttgagcatccgcttgtttgtattgatgtcattgaagaaggt
attgtttcgggaccccgagctgggctctggaaggaagcaaatgctttccagggtcttctt
ttcgcggatacatgtaaaaacttagttcatgtattcttttctcaacgggcaacatcaaag
gttcctggtgctacagacttgggattgatgcctaggaaagttactaaagttgccattcta
ggtggtggacttatgggttcaggaattgcaactgcgatgatactgagtaattatcctgtt
atactcaaagaagtaaatgagaagtttctaaatgctggaattgacagaattaaagccaat
ttgcagagtcgtgtgaggaaagggaaaatgacagaggagagatatgagaaagccatgtct
cttgtaacaggtgtcctcgattatgaaaggttcaaagacgtggatttagttattgaggct
gttattgaaaatgtgaaattgaaacagcaaatattttctgacttggagaagtactgtcct
tcccattgtgtccttgctactaatacatctacaattgatcttaatctaattggtgagaaa
acaaggtccaaagaccgtattgtcggtgcacacttctttagccctgcacatgtcatgcca
cttctggaaatagtccgcacccagcacacctcaccacaagttgtcgttgatttgcttgat
gttgggaagaaaatcaagaagacaccaatagtggttgggaactgtaccggtttcgcagtc
aacagaatgttctttccttacactcagtcagcactcctgttcgttgatcttggtatggat
gtgtacaagatcgatcgtgcatgtaccaaatttggaatgcccatgggtccattcagactg
gcagacctcgttggttttggtgttgctgcggccactggtatgcagtaccttgagaacttc
ccagagagggtctacaagtcaatgttgattcctcttatgatggaggacaaaaggacaggt
gaggcctctcggaagggcttttacaagtatgaggacaagaggaaggcaactcctgatccc
gaaattatgaaatatattgaaaaatctaggagtatggctggagtaacaccagacactgag
ttgatgaagctaagtgagaaggacatagttgagatggtcttcttcccagtcataaatgag
gcttgccgtgttcttgatgagggaattgcagtcaaggcttctgaccttgacattgcctca
atctttggcatgggattcccaccgtataggggaggaatcatgttctgggcagattccatt
ggtgcaaagtacatccatgacaagttggaggtgtgggcgaagcggtatagcgacatcttc
aagccttgttcctaccttgcagaaagagcagcaaatggggttcctctgagtgcaccagct
aagcaagtcaaggcccgactatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328997
Entry
4328997           CDS       T01015                                 
Name
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4328997
   00592 alpha-Linolenic acid metabolism
    4328997
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     4328997
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     4328997
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4328997
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 Pyr_redox F420_oxidored
Other DBs
NCBI-GeneID: 4328997
NCBI-ProteinID: XP_015625624
UniProt: Q8W1L6 S4U008
LinkDB
Position
2:10001469..10010142
AA seq 726 aa
MAGAIRVTMEVGADGVAVVTICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGG
KFCGGFDINVFTEVHKTGNVSLMPDVSVELVSNLMEAGKKPSVAAIQGLALGGGLELTMG
CHARISTPEAQLGLPELTLGIIPGFGGTQRLPRLVGLPKAIEMMLQSKFITAKEGKEGGL
VDALCSPDELIKMSRLWALEIANYRKPWIRSLARTDRLGSLSEARSVLNSARQQAKKVAA
NLPQHQACLDVMEEGVLCGGHAGVLKEAKVFKELVLSPTSKALVHAFFAQRLTTKVPGVT
DVQLKPRKIRKVAVIGGGLMGSGIATALLVSNTSVVLKEVNPQFLQRGQKMIAANLEGLV
KRGSLTKDKMNKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDLEKVCPPHCIL
ATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQAILDLITVGKMI
KKVPVVVGNCTGFAVNRTFFPYTQGSHLLVSIGIDVFRIDRVISSFGMPMGPFQLQDLAG
YGVALAVKDIYAAAFGTRNLDSNLVDLMVQNGRQGKSNGKGYYLYEKGGKPKPDPSVQVV
IDEYRRCAKTMPGGKPVTLSDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMG
FPKFRGGLVFWADTIGAPYIHSKLSKWTEIYGDFFKPSSYLEDRAKRSLPLSAPNATQQA
SSRSRM
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggcgggggcgatccgcgtcaccatggaggtgggcgccgacggcgtcgcggtcgtcacc
atctgcaacccgcccgtcaatgcgctgcatcccatcatcatccagggattgaaggagaag
tacgcggaggcgatggatcgcgacgacgtcaaggccatcgtgctcaccggtgctggaggc
aaattttgtggaggctttgatatcaatgtgttcacagaagttcacaagactggaaatgta
tctcttatgcctgatgtatctgttgagcttgtgtcgaatttgatggaagcgggcaaaaag
ccttcagttgctgccattcaaggccttgctcttggtggcggtttggagttgaccatgggt
tgccatgctcggatatctacccctgaagctcaacttggactaccagagttgactctgggc
ataattcctggatttggaggaacccagcgtctgccaaggcttgtaggtctgcccaaagca
atagaaatgatgctgcaatcaaagttcatcacagcaaaggaagggaaagaaggtggtctt
gttgatgccctgtgctcccctgatgagttgataaagatgtcacgcctttgggctctggag
atagctaattaccgtaaaccttggataagatctcttgccagaacagataggcttggttca
ctgtctgaagctcgttctgtattaaatagtgcaagacagcaagcgaagaaggttgcagca
aacttgccacagcaccaggcctgcctagatgttatggaagaaggtgtactatgtggaggc
catgctggtgttctgaaggaggccaaggttttcaaggagttggtgctatcaccaacatca
aaggcacttgtacatgctttctttgcccagcgtttaaccacaaaggtgccaggtgttact
gatgttcaattgaaacctaggaaaataagaaaagttgctgttattggtggtggtttgatg
ggctctggaattgcaacagctcttcttgttagcaatacatccgttgtgcttaaggaagta
aatcctcaattcctgcaaaggggacagaagatgatagcagctaatcttgagggtctagtc
aagaggggctcattgacaaaggacaagatgaacaaggccatgtcacttctcaagggtgca
ttggattattctgatttcaaggatgttgatatggtcatcgaggctgtcatagagaagatt
cctttgaaacaatcaatattttctgaccttgagaaagtatgcccaccccactgcatactt
gcaacaaacacatctaccatcgatttgaatgttgtgggcgagaagacaaattctcaagat
agaattataggggcacatttctttagccctgcccatattatgcctttgcttgaaattgtc
cggacggagaagacatcaccgcaagctattcttgatctcatcacagttgggaaaatgata
aagaaagtccctgttgtggttgggaactgcacaggcttcgcagtcaatcgtacatttttc
ccttacacacagggttctcatcttctagttagtattgggatcgacgttttcagaattgat
cgagtaataagcagctttggcatgccaatgggaccttttcaactgcaagatctggctgga
tatggagtggcattggcagtaaaggatatctatgcggctgcctttggaacaaggaatctg
gactctaatctggtggatttgatggtacagaatggacggcagggaaagagcaatggtaaa
ggttattacctttatgagaagggtgggaagccgaagcctgacccaagtgttcaggttgtg
attgacgagtacagaagatgtgcaaagacaatgcctggtggaaagcctgttactttatct
gatcaagatatattggagatgattttcttcccagttgttaatgaggcatgcagggtcatg
gatgaaaatgttgtgatccgagcttctgatcttgatattgcttctatccttgggatgggt
tttcccaagttcaggggtggtcttgtcttttgggctgacactattggagcaccttatata
cattcaaagcttagcaagtggactgaaatttatggcgatttcttcaaaccatcatcctat
ttggaagatagagctaaaagaagcctaccattgagcgcaccaaacgcaacccagcaggct
tcgtcgaggtcacgcatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332628
Entry
4332628           CDS       T01015                                 
Name
(RefSeq) short-chain-enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00280  Valine, leucine and isoleucine degradation
osa00310  Lysine degradation
osa00360  Phenylalanine metabolism
osa00380  Tryptophan metabolism
osa00410  beta-Alanine metabolism
osa00640  Propanoate metabolism
osa00650  Butanoate metabolism
osa00903  Limonene and pinene degradation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4332628
   00650 Butanoate metabolism
    4332628
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4332628
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    4332628
   00310 Lysine degradation
    4332628
   00360 Phenylalanine metabolism
    4332628
   00380 Tryptophan metabolism
    4332628
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4332628
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    4332628
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4332628
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-GeneID: 4332628
NCBI-ProteinID: XP_015632322
LinkDB
Position
3:11068947..11071086
AA seq 312 aa
MQYCSVKRSLPKKRDTSTRYSHPHSRRSSVYQTEKLVNPTPPDPMAATSPDSGDLILVEP
AKPGSRVAVVTINRPKALNALTRPMMVSLAAAFRRLDADDGVAAVVLAGRGRAFCSGVDL
TAAEEVFKGDVKDPAADPVVQMERCRKPIVGAIAGFAVTAGFEIALACDILVAGRSAKFI
DTHAKFGIFPSWGLSQKLSRVIGPNRAREVSLTCMPITAEMAEKWGLVNHIVDDTQVLSK
AIEVCEAIARNNRNLVVLYKSVINDGLQLDLEHARALEKERAHDYYNGMTKEQFASMQKF
IQGRSSKPPSKL
NT seq 939 nt   +upstreamnt  +downstreamnt
atgcagtattgcagtgtcaaaaggtctcttccaaaaaaaagagacacgagcacacgctac
tcccatccccactctcgtcgctcgtcggtataccaaaccgaaaagctagtcaatccgacc
ccacccgatccgatggccgccacatcgccggactccggcgacctcatcctggtcgagccg
gccaagccggggtcccgggtcgccgtcgtcaccatcaaccggcccaaagcgctgaacgcg
ctgacgcggcccatgatggtctcactggccgcggcgttccggcggctggacgccgacgac
ggggtggcggcggtggtgctcgcggggcgcggccgcgcgttctgctccggcgtggacctg
accgctgcggaggaggtgttcaagggcgacgtgaaggatcccgccgccgaccccgtcgtc
cagatggagcgctgtcgcaagcccatcgtcggcgccatcgccggattcgccgtcaccgcc
ggatttgagatcgccctcgcctgcgacatcctagtggccggccgctccgctaagttcatc
gacacccacgccaagtttgggatattcccttcttggggtctttcacagaagctttctcgt
gtcattggaccaaatagagcacgggaagtgtcgttaacttgcatgcctatcacagctgaa
atggcggagaagtggggtcttgttaaccacattgtggatgatacccaggtgctgagtaag
gcaatagaggtctgtgaggccattgcaaggaacaatcgcaacttggttgtgttgtataaa
tctgttataaatgacgggctccagctggacttggaacatgctcgagctcttgaaaaggaa
agagctcatgactattacaatggtatgacaaaagagcaattcgcaagtatgcagaaattt
atacagggccggagttcgaagccaccatcaaagctgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337848
Entry
4337848           CDS       T01015                                 
Name
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4337848
   00592 alpha-Linolenic acid metabolism
    4337848
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     4337848
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     4337848
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4337848
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2
Other DBs
NCBI-GeneID: 4337848
NCBI-ProteinID: XP_015639199
LinkDB
Position
5:complement(3219996..3228130)
AA seq 724 aa
MAEKGRTEMEVRPGGVALITISNPPVNALSIHVLYSLKDHYEEALRRNDVKAIVVTGKGG
VFSGGLDINTFGAIQRNKAEQLKVDYVSIDVMTNTLEAAGKPSVAAINGPALGGGLEISM
VCQARISIPTAQLGLPELQLGVIPAFGGTQRLPRLVGLTKALEMMLMSKPIKAEEAHQLA
LIDAIVSPNDLLNTACRWALDISESRRPWVHTLSRTDKLESPDEAREILKFARAQVQKQA
ANLRHPLVCIDVIEEGIVSGPQAGLRKEAIAFQDLVFSDTCKSLVHVFFSQRATSKVPGI
TDLGLMPRKVSKVAIVGGGLMGSGIATALMLSNYPVVLKEVNDKFLDAGIDRIKANLQSR
VRNGKMTKEIYEKTLSLLTGVVDYERFKDVDLVIEAVVENVKVKQQVFADLERYCPSHCV
LATNTSTIDLDLIGEKTNSQDRIAGAHFFSPAHVMPLLEIVRSNHTSPQVVVDLLDVGKK
IKKTPVVVGNCTGFAVNRMFSPYTSIALLLVDRGMDVYKIDQVCTEFGMPMGPFRLLDLV
GFGVALASGMQYLENSPGSVDKSMLIPLMFEDKRTGEASQKGFYKYEGNRKAIPDPDIFK
YVEKSRRMAGTVPDLELLKLDDKEIVEMVFFPVINEACQVLSEGIANKASDLDIASIFGM
GFPPYRGGIVYWADSIGAKRIHARLSEWEMKHGQLFRPCSYLSERAAEGVPLSSTAKNNA
KARM
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggcggagaaggggaggacggagatggaggtccggcccggcggcgtcgccctcatcacc
atctccaaccctcccgtcaatgccctctccatccacgtcttgtatagcttgaaggaccac
tatgaagaagcacttaggaggaatgatgttaaagctattgttgtcacaggaaaaggagga
gtattttccgggggactagacattaatacatttggtgctattcagagaaacaaagcggag
cagctaaaggttgattatgtgtccatagatgtcatgactaatactcttgaagctgctgga
aagccatcagtagctgctatcaacggtcctgctcttggtggagggttagaaatttccatg
gtatgtcaagcacgcatttcgattccaacggctcaattaggtcttccagagcttcaactt
ggagtgatccctgcatttggaggaacacaacgacttccccgccttgttggactaacaaaa
gcacttgaaatgatgctgatgtccaagcctattaaagccgaagaggcccatcagctggcc
ctcatcgatgccatagtttcacctaatgatttgctgaatactgcctgccgttgggccttg
gatatatccgaatctagaaggccatgggtccataccctcagtagaactgacaagctagag
tctcctgatgaggccagggagatcctcaagtttgccagagctcaggttcagaagcaggct
gccaatcttcggcacccacttgtctgtattgatgttatcgaggaaggtatagtttcagga
ccccaagctgggctacggaaggaagccattgctttccaggaccttgttttctcagataca
tgtaaaagcttggttcatgtctttttttcacagcgtgcgacatcaaaggttcctgggatc
acagacttaggtttaatgcctaggaaggtatctaaagttgccattgttgggggtgggctt
atgggttctgggattgcaactgcactgatgctgagtaattatcctgttgtactcaaagaa
gtaaacgacaaattcttggacgcaggaattgacaggatcaaagcaaatttgcagagtcgt
gtgaggaatgggaaaatgaccaaggagatatacgaaaaaacgctctcacttcttacaggt
gtcgttgattacgagagattcaaggacgtagatttagttattgaggcagttgtagagaat
gtgaaggtgaagcagcaagtgtttgctgacttggagcggtactgtccttcccattgtgta
cttgccactaacacttctaccattgatcttgacctgattggagagaagacaaactcccaa
gatcgcattgccggtgcgcacttttttagtccagctcatgtgatgccacttctggaaata
gtccgctccaatcatacctcaccacaagtagttgttgatttgctggatgtggggaagaag
atcaagaagacaccagtagtggttgggaattgtaccggctttgcggttaaccggatgttc
tctccctatactagtatagcgctcttgcttgttgatcgtggaatggatgtttacaagatt
gatcaagtttgtaccgaatttgggatgccaatgggtccattcagattgctagacctggtt
gggtttggagtagctcttgcctctggcatgcagtaccttgagaactcccccgggagtgtc
gacaagtcaatgctaattcctctcatgtttgaagacaaaaggacaggcgaagcctctcaa
aagggattttacaagtatgagggtaatcggaaggccatccctgatcctgatatcttcaag
tatgttgagaagtcaaggagaatggctggaactgtgcctgatcttgagctactgaagctt
gacgacaaggaaatagtggagatggtgttcttccctgttatcaacgaggcctgccaggtc
ctcagtgagggcattgccaacaaagcctcggacctcgacatcgcctcaatcttcggcatg
ggatttccaccatacaggggtggcatcgtgtactgggccgattccatcggcgcaaagcgc
attcacgcaaggctatcagagtgggagatgaagcatggccagttgttcaggccttgctca
tacctgtcagaaagggcagcagaaggtgttcctctgagctccaccgcgaagaacaatgcc
aaggcccggatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338541
Entry
4338541           CDS       T01015                                 
Name
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4338541
   00592 alpha-Linolenic acid metabolism
    4338541
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     4338541
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     4338541
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4338541
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 SPOB_a
Other DBs
NCBI-GeneID: 4338541
NCBI-ProteinID: XP_015637822
UniProt: B9FP59
LinkDB
Position
5:17289197..17296388
AA seq 718 aa
MARGSTSVEVRRDGVAVITVSNPPVNALSLDVIASLQRDYGEALRRSDVKAIVLTGAKGR
FSGGFDINAFDKKPKNEKPGYLSIDFLTDIVEDAPKPSVAAIDGVALGGGLELVMVCHAR
VSTSSAQLGLPELQLGIIPGLGGTQRLPRLVGLPKALEMLLMSKPLKGVEAHKFGLVDAV
VSADELISTACSWALEIVEDKRPWFRSLHRTDRLPALEETKKILNFARVQAQKQSASLQH
PLVCIDVIEEGIISGPRAGLMKETLCGKMLEMSQISKSLRHVFFAQRATSKIPNISILGL
TPRRIHKVAIVGGGLMGSGIATALISNNLLVILKEVNEQFLDAGISRVKANLQSLVKRGQ
MTKEDYENKLSLLSGVLDYEQFREADVVIEAVIEDLSLKQKIFADLEKYCHSNCILATNT
STIDLHLIGQKTSCQDRIAGAHFFSPAHAMPLLEIIRTHRTSSQVVIDLLNVAKQIRKTP
IVVGNCTGFAVNRMFFPFTQVAYFLVDYGLDVYHIDHVITKFGMPMGPFRLADLVGFGVA
IASRKQYLQSYPERCYKSMLIQIMLEENRTGESSRKGFYLYDDKRKASPDPEMNKYIEKS
RSMASIVQDPKLPKLTDDEIVEMMLFPVVNEACRLLDEGVAMKASDLDVASIMGRGFPSY
RGGVMFWADSFGAKYIYDRLKDWSKYHGGIFEPYEYLSTRARQGLSLAAMADGAMSRL
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggcgagaggctccacctccgtggaggtccgccgcgacggcgtcgccgtcatcaccgtc
tccaacccccccgtgaacgcgctctccctcgacgtgatagccagcttgcagagagattat
ggggaagctctgaggaggagtgatgtcaaggcaattgttctcactggcgccaaagggagg
ttttctggaggctttgatataaacgcattcgacaagaagccaaaaaatgagaagcctgga
tatctgtctattgattttttaacggacatagtagaagatgctccgaaaccatcagtggct
gctatagatggcgttgctctaggtggcggcttagagcttgtaatggtttgtcacgctcgt
gtttctacatcttcggctcaattaggattacctgaacttcaactgggcatcattcctggg
ttgggaggaacacaacgactgccccgccttgttggcctgccaaaagctcttgagatgttg
ttgatgtctaaacctctaaaaggagtggaggcacataaatttggtttagttgacgctgta
gtttcagctgatgaattgatcagcacggcctgttcctgggctctggaaattgttgaagac
aaacgcccatggttcaggagtctccatagaaccgatagacttccagctcttgaggaaacg
aagaaaattctgaattttgcaagagttcaggcccaaaagcagtctgctagtctccaacat
cccttagtttgcattgatgtcattgaggagggcataatttctggccctcgagctggccta
atgaaggaaacactttgtggaaaaatgcttgagatgtctcagataagcaaaagcttaagg
catgtcttttttgcacaacgtgcaacttcaaagattccaaatatcagcatattggggttg
acaccacggagaatacacaaggtggctattgttgggggaggtctaatgggatctggaata
gcaactgcattgatatcgaacaacctcctggtaatcctgaaagaagtcaatgagcagttc
ttagatgctggtattagcagagttaaagctaatctgcagagcttagtcaaaagggggcaa
atgaccaaagaagattatgaaaataaactttctttactatctggtgttcttgactatgaa
caatttagagaagctgatgtggtcattgaggcagttattgaggatttatcactaaagcag
aaaatatttgctgaccttgaaaaatactgccactctaattgcatacttgccacgaatact
tcaacaatagaccttcatttaattggccaaaagacatcttgccaggatcgaattgctggt
gcacacttcttcagtccagcccatgcaatgccactgttggaaataatccgtactcatcgg
acttcctcacaagttgtcattgacttgctaaacgtggcaaaacagatacgaaaaacacca
atagttgttgggaactgcacaggttttgctgtgaatcggatgttctttcctttcacacag
gtggcttattttcttgttgattatggtctggatgtctaccacatagaccatgtgattaca
aagtttggaatgccaatgggacctttccgattagctgatcttgttggttttggagttgct
attgcctccagaaagcaatatctccaaagttatcctgagcgatgttacaagtcaatgctt
attcaaattatgcttgaggaaaacaggacaggtgaatcttcacgcaaaggattttatctt
tatgatgataagcgaaaggcttctccagatcctgaaatgaacaagtacattgagaaatca
agaagcatggctagtattgtacaagatcctaagctgccgaaattaacagatgatgaaatc
gtggagatgatgctcttccccgtggtgaatgaggcctgtcgactgcttgacgagggggtt
gctatgaaagcatctgatcttgatgtagcatccattatggggaggggcttcccttcctac
aggggcggagtgatgttctgggccgattcgtttggcgcgaaatacatttacgacagactg
aaggattggtccaagtatcacggagggatctttgaaccctatgaatatttatcaacaaga
gctcgtcagggtttgtctctggccgccatggctgatggtgcaatgtcacggctctag

DBGET integrated database retrieval system