KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326503
Entry
4326503           CDS       T01015                                 
Name
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4326503
   00592 alpha-Linolenic acid metabolism
    4326503
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     4326503
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     4326503
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4326503
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2
Other DBs
NCBI-GeneID: 4326503
NCBI-ProteinID: XP_015621075
UniProt: A0A8J8XZW7 Q94CN1
LinkDB
Position
1:13887277..13893142
AA seq 727 aa
MAAAAAAKGRTEMEVGADGVAVITICNPPVNSLSIDVLLSLKENYAEALRRNDVKAIVVT
GKGGKFSGGFDISSFGSVQGGKVEQPKVGYISIDIITDTLEAATKPSVAAIDGLALGGGL
EVAMACHARISTPTAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMMLLSKPIKGAEA
HQLGLVDSLVSADDLVNTARRWALDICELKRPWIKSLYKTDKLEPLGEAREILKFARAQA
RRQAANLEHPLVCIDVIEEGIVSGPRAGLWKEANAFQGLLFADTCKNLVHVFFSQRATSK
VPGATDLGLMPRKVTKVAILGGGLMGSGIATAMILSNYPVILKEVNEKFLNAGIDRIKAN
LQSRVRKGKMTEERYEKAMSLVTGVLDYERFKDVDLVIEAVIENVKLKQQIFSDLEKYCP
SHCVLATNTSTIDLNLIGEKTRSKDRIVGAHFFSPAHVMPLLEIVRTQHTSPQVVVDLLD
VGKKIKKTPIVVGNCTGFAVNRMFFPYTQSALLFVDLGMDVYKIDRACTKFGMPMGPFRL
ADLVGFGVAAATGMQYLENFPERVYKSMLIPLMMEDKRTGEASRKGFYKYEDKRKATPDP
EIMKYIEKSRSMAGVTPDTELMKLSEKDIVEMVFFPVINEACRVLDEGIAVKASDLDIAS
IFGMGFPPYRGGIMFWADSIGAKYIHDKLEVWAKRYSDIFKPCSYLAERAANGVPLSAPA
KQVKARL
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggccgcggcggcggcggcgaaggggaggacggagatggaggtcggagcggacggcgtc
gccgtcatcaccatctgcaacccgcccgtcaactcgctctccatcgatgtattgctaagc
ttaaaggaaaactatgctgaagctcttcggaggaatgatgtgaaagctattgttgttaca
gggaaaggaggaaaattttctggaggatttgatattagttcctttggtagtgttcagggt
ggcaaagttgaacagccaaaggttggttacatatcaatagatattatcactgatacccta
gaagctgcaacaaagccatcagtggctgcaattgatggtcttgctcttggtggaggattg
gaagttgctatggcatgccatgcacgcatttcaactcccacagctcaattaggacttcca
gaacttcaacttggagttattccaggatttggaggaacacaacgactcccgcgtcttgtt
ggattgacaaaagcacttgaaatgatgctgctatctaagccaattaagggtgcagaggca
caccaattgggtcttgttgattccttggtttctgctgatgatttggttaatactgctcgt
cgttgggctttggatatctgtgaattaaaaaggccatggatcaaaagtctttataagact
gacaaactagaaccacttggtgaggctagggagattctcaagtttgcaagagctcaagct
cgaaggcaggctgccaatcttgagcatccgcttgtttgtattgatgtcattgaagaaggt
attgtttcgggaccccgagctgggctctggaaggaagcaaatgctttccagggtcttctt
ttcgcggatacatgtaaaaacttagttcatgtattcttttctcaacgggcaacatcaaag
gttcctggtgctacagacttgggattgatgcctaggaaagttactaaagttgccattcta
ggtggtggacttatgggttcaggaattgcaactgcgatgatactgagtaattatcctgtt
atactcaaagaagtaaatgagaagtttctaaatgctggaattgacagaattaaagccaat
ttgcagagtcgtgtgaggaaagggaaaatgacagaggagagatatgagaaagccatgtct
cttgtaacaggtgtcctcgattatgaaaggttcaaagacgtggatttagttattgaggct
gttattgaaaatgtgaaattgaaacagcaaatattttctgacttggagaagtactgtcct
tcccattgtgtccttgctactaatacatctacaattgatcttaatctaattggtgagaaa
acaaggtccaaagaccgtattgtcggtgcacacttctttagccctgcacatgtcatgcca
cttctggaaatagtccgcacccagcacacctcaccacaagttgtcgttgatttgcttgat
gttgggaagaaaatcaagaagacaccaatagtggttgggaactgtaccggtttcgcagtc
aacagaatgttctttccttacactcagtcagcactcctgttcgttgatcttggtatggat
gtgtacaagatcgatcgtgcatgtaccaaatttggaatgcccatgggtccattcagactg
gcagacctcgttggttttggtgttgctgcggccactggtatgcagtaccttgagaacttc
ccagagagggtctacaagtcaatgttgattcctcttatgatggaggacaaaaggacaggt
gaggcctctcggaagggcttttacaagtatgaggacaagaggaaggcaactcctgatccc
gaaattatgaaatatattgaaaaatctaggagtatggctggagtaacaccagacactgag
ttgatgaagctaagtgagaaggacatagttgagatggtcttcttcccagtcataaatgag
gcttgccgtgttcttgatgagggaattgcagtcaaggcttctgaccttgacattgcctca
atctttggcatgggattcccaccgtataggggaggaatcatgttctgggcagattccatt
ggtgcaaagtacatccatgacaagttggaggtgtgggcgaagcggtatagcgacatcttc
aagccttgttcctaccttgcagaaagagcagcaaatggggttcctctgagtgcaccagct
aagcaagtcaaggcccgactatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328997
Entry
4328997           CDS       T01015                                 
Name
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4328997
   00592 alpha-Linolenic acid metabolism
    4328997
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     4328997
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     4328997
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4328997
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 Pyr_redox F420_oxidored
Other DBs
NCBI-GeneID: 4328997
NCBI-ProteinID: XP_015625624
UniProt: Q8W1L6 S4U008
LinkDB
Position
2:10001469..10010142
AA seq 726 aa
MAGAIRVTMEVGADGVAVVTICNPPVNALHPIIIQGLKEKYAEAMDRDDVKAIVLTGAGG
KFCGGFDINVFTEVHKTGNVSLMPDVSVELVSNLMEAGKKPSVAAIQGLALGGGLELTMG
CHARISTPEAQLGLPELTLGIIPGFGGTQRLPRLVGLPKAIEMMLQSKFITAKEGKEGGL
VDALCSPDELIKMSRLWALEIANYRKPWIRSLARTDRLGSLSEARSVLNSARQQAKKVAA
NLPQHQACLDVMEEGVLCGGHAGVLKEAKVFKELVLSPTSKALVHAFFAQRLTTKVPGVT
DVQLKPRKIRKVAVIGGGLMGSGIATALLVSNTSVVLKEVNPQFLQRGQKMIAANLEGLV
KRGSLTKDKMNKAMSLLKGALDYSDFKDVDMVIEAVIEKIPLKQSIFSDLEKVCPPHCIL
ATNTSTIDLNVVGEKTNSQDRIIGAHFFSPAHIMPLLEIVRTEKTSPQAILDLITVGKMI
KKVPVVVGNCTGFAVNRTFFPYTQGSHLLVSIGIDVFRIDRVISSFGMPMGPFQLQDLAG
YGVALAVKDIYAAAFGTRNLDSNLVDLMVQNGRQGKSNGKGYYLYEKGGKPKPDPSVQVV
IDEYRRCAKTMPGGKPVTLSDQDILEMIFFPVVNEACRVMDENVVIRASDLDIASILGMG
FPKFRGGLVFWADTIGAPYIHSKLSKWTEIYGDFFKPSSYLEDRAKRSLPLSAPNATQQA
SSRSRM
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggcgggggcgatccgcgtcaccatggaggtgggcgccgacggcgtcgcggtcgtcacc
atctgcaacccgcccgtcaatgcgctgcatcccatcatcatccagggattgaaggagaag
tacgcggaggcgatggatcgcgacgacgtcaaggccatcgtgctcaccggtgctggaggc
aaattttgtggaggctttgatatcaatgtgttcacagaagttcacaagactggaaatgta
tctcttatgcctgatgtatctgttgagcttgtgtcgaatttgatggaagcgggcaaaaag
ccttcagttgctgccattcaaggccttgctcttggtggcggtttggagttgaccatgggt
tgccatgctcggatatctacccctgaagctcaacttggactaccagagttgactctgggc
ataattcctggatttggaggaacccagcgtctgccaaggcttgtaggtctgcccaaagca
atagaaatgatgctgcaatcaaagttcatcacagcaaaggaagggaaagaaggtggtctt
gttgatgccctgtgctcccctgatgagttgataaagatgtcacgcctttgggctctggag
atagctaattaccgtaaaccttggataagatctcttgccagaacagataggcttggttca
ctgtctgaagctcgttctgtattaaatagtgcaagacagcaagcgaagaaggttgcagca
aacttgccacagcaccaggcctgcctagatgttatggaagaaggtgtactatgtggaggc
catgctggtgttctgaaggaggccaaggttttcaaggagttggtgctatcaccaacatca
aaggcacttgtacatgctttctttgcccagcgtttaaccacaaaggtgccaggtgttact
gatgttcaattgaaacctaggaaaataagaaaagttgctgttattggtggtggtttgatg
ggctctggaattgcaacagctcttcttgttagcaatacatccgttgtgcttaaggaagta
aatcctcaattcctgcaaaggggacagaagatgatagcagctaatcttgagggtctagtc
aagaggggctcattgacaaaggacaagatgaacaaggccatgtcacttctcaagggtgca
ttggattattctgatttcaaggatgttgatatggtcatcgaggctgtcatagagaagatt
cctttgaaacaatcaatattttctgaccttgagaaagtatgcccaccccactgcatactt
gcaacaaacacatctaccatcgatttgaatgttgtgggcgagaagacaaattctcaagat
agaattataggggcacatttctttagccctgcccatattatgcctttgcttgaaattgtc
cggacggagaagacatcaccgcaagctattcttgatctcatcacagttgggaaaatgata
aagaaagtccctgttgtggttgggaactgcacaggcttcgcagtcaatcgtacatttttc
ccttacacacagggttctcatcttctagttagtattgggatcgacgttttcagaattgat
cgagtaataagcagctttggcatgccaatgggaccttttcaactgcaagatctggctgga
tatggagtggcattggcagtaaaggatatctatgcggctgcctttggaacaaggaatctg
gactctaatctggtggatttgatggtacagaatggacggcagggaaagagcaatggtaaa
ggttattacctttatgagaagggtgggaagccgaagcctgacccaagtgttcaggttgtg
attgacgagtacagaagatgtgcaaagacaatgcctggtggaaagcctgttactttatct
gatcaagatatattggagatgattttcttcccagttgttaatgaggcatgcagggtcatg
gatgaaaatgttgtgatccgagcttctgatcttgatattgcttctatccttgggatgggt
tttcccaagttcaggggtggtcttgtcttttgggctgacactattggagcaccttatata
cattcaaagcttagcaagtggactgaaatttatggcgatttcttcaaaccatcatcctat
ttggaagatagagctaaaagaagcctaccattgagcgcaccaaacgcaacccagcaggct
tcgtcgaggtcacgcatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337848
Entry
4337848           CDS       T01015                                 
Name
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4337848
   00592 alpha-Linolenic acid metabolism
    4337848
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     4337848
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     4337848
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4337848
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2
Other DBs
NCBI-GeneID: 4337848
NCBI-ProteinID: XP_015639199
LinkDB
Position
5:complement(3219996..3228130)
AA seq 724 aa
MAEKGRTEMEVRPGGVALITISNPPVNALSIHVLYSLKDHYEEALRRNDVKAIVVTGKGG
VFSGGLDINTFGAIQRNKAEQLKVDYVSIDVMTNTLEAAGKPSVAAINGPALGGGLEISM
VCQARISIPTAQLGLPELQLGVIPAFGGTQRLPRLVGLTKALEMMLMSKPIKAEEAHQLA
LIDAIVSPNDLLNTACRWALDISESRRPWVHTLSRTDKLESPDEAREILKFARAQVQKQA
ANLRHPLVCIDVIEEGIVSGPQAGLRKEAIAFQDLVFSDTCKSLVHVFFSQRATSKVPGI
TDLGLMPRKVSKVAIVGGGLMGSGIATALMLSNYPVVLKEVNDKFLDAGIDRIKANLQSR
VRNGKMTKEIYEKTLSLLTGVVDYERFKDVDLVIEAVVENVKVKQQVFADLERYCPSHCV
LATNTSTIDLDLIGEKTNSQDRIAGAHFFSPAHVMPLLEIVRSNHTSPQVVVDLLDVGKK
IKKTPVVVGNCTGFAVNRMFSPYTSIALLLVDRGMDVYKIDQVCTEFGMPMGPFRLLDLV
GFGVALASGMQYLENSPGSVDKSMLIPLMFEDKRTGEASQKGFYKYEGNRKAIPDPDIFK
YVEKSRRMAGTVPDLELLKLDDKEIVEMVFFPVINEACQVLSEGIANKASDLDIASIFGM
GFPPYRGGIVYWADSIGAKRIHARLSEWEMKHGQLFRPCSYLSERAAEGVPLSSTAKNNA
KARM
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggcggagaaggggaggacggagatggaggtccggcccggcggcgtcgccctcatcacc
atctccaaccctcccgtcaatgccctctccatccacgtcttgtatagcttgaaggaccac
tatgaagaagcacttaggaggaatgatgttaaagctattgttgtcacaggaaaaggagga
gtattttccgggggactagacattaatacatttggtgctattcagagaaacaaagcggag
cagctaaaggttgattatgtgtccatagatgtcatgactaatactcttgaagctgctgga
aagccatcagtagctgctatcaacggtcctgctcttggtggagggttagaaatttccatg
gtatgtcaagcacgcatttcgattccaacggctcaattaggtcttccagagcttcaactt
ggagtgatccctgcatttggaggaacacaacgacttccccgccttgttggactaacaaaa
gcacttgaaatgatgctgatgtccaagcctattaaagccgaagaggcccatcagctggcc
ctcatcgatgccatagtttcacctaatgatttgctgaatactgcctgccgttgggccttg
gatatatccgaatctagaaggccatgggtccataccctcagtagaactgacaagctagag
tctcctgatgaggccagggagatcctcaagtttgccagagctcaggttcagaagcaggct
gccaatcttcggcacccacttgtctgtattgatgttatcgaggaaggtatagtttcagga
ccccaagctgggctacggaaggaagccattgctttccaggaccttgttttctcagataca
tgtaaaagcttggttcatgtctttttttcacagcgtgcgacatcaaaggttcctgggatc
acagacttaggtttaatgcctaggaaggtatctaaagttgccattgttgggggtgggctt
atgggttctgggattgcaactgcactgatgctgagtaattatcctgttgtactcaaagaa
gtaaacgacaaattcttggacgcaggaattgacaggatcaaagcaaatttgcagagtcgt
gtgaggaatgggaaaatgaccaaggagatatacgaaaaaacgctctcacttcttacaggt
gtcgttgattacgagagattcaaggacgtagatttagttattgaggcagttgtagagaat
gtgaaggtgaagcagcaagtgtttgctgacttggagcggtactgtccttcccattgtgta
cttgccactaacacttctaccattgatcttgacctgattggagagaagacaaactcccaa
gatcgcattgccggtgcgcacttttttagtccagctcatgtgatgccacttctggaaata
gtccgctccaatcatacctcaccacaagtagttgttgatttgctggatgtggggaagaag
atcaagaagacaccagtagtggttgggaattgtaccggctttgcggttaaccggatgttc
tctccctatactagtatagcgctcttgcttgttgatcgtggaatggatgtttacaagatt
gatcaagtttgtaccgaatttgggatgccaatgggtccattcagattgctagacctggtt
gggtttggagtagctcttgcctctggcatgcagtaccttgagaactcccccgggagtgtc
gacaagtcaatgctaattcctctcatgtttgaagacaaaaggacaggcgaagcctctcaa
aagggattttacaagtatgagggtaatcggaaggccatccctgatcctgatatcttcaag
tatgttgagaagtcaaggagaatggctggaactgtgcctgatcttgagctactgaagctt
gacgacaaggaaatagtggagatggtgttcttccctgttatcaacgaggcctgccaggtc
ctcagtgagggcattgccaacaaagcctcggacctcgacatcgcctcaatcttcggcatg
ggatttccaccatacaggggtggcatcgtgtactgggccgattccatcggcgcaaagcgc
attcacgcaaggctatcagagtgggagatgaagcatggccagttgttcaggccttgctca
tacctgtcagaaagggcagcagaaggtgttcctctgagctccaccgcgaagaacaatgcc
aaggcccggatgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338541
Entry
4338541           CDS       T01015                                 
Name
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01212  Fatty acid metabolism
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4338541
   00592 alpha-Linolenic acid metabolism
    4338541
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     4338541
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     4338541
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     4338541
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Pyr_redox_2 SPOB_a
Other DBs
NCBI-GeneID: 4338541
NCBI-ProteinID: XP_015637822
UniProt: B9FP59
LinkDB
Position
5:17289197..17296388
AA seq 718 aa
MARGSTSVEVRRDGVAVITVSNPPVNALSLDVIASLQRDYGEALRRSDVKAIVLTGAKGR
FSGGFDINAFDKKPKNEKPGYLSIDFLTDIVEDAPKPSVAAIDGVALGGGLELVMVCHAR
VSTSSAQLGLPELQLGIIPGLGGTQRLPRLVGLPKALEMLLMSKPLKGVEAHKFGLVDAV
VSADELISTACSWALEIVEDKRPWFRSLHRTDRLPALEETKKILNFARVQAQKQSASLQH
PLVCIDVIEEGIISGPRAGLMKETLCGKMLEMSQISKSLRHVFFAQRATSKIPNISILGL
TPRRIHKVAIVGGGLMGSGIATALISNNLLVILKEVNEQFLDAGISRVKANLQSLVKRGQ
MTKEDYENKLSLLSGVLDYEQFREADVVIEAVIEDLSLKQKIFADLEKYCHSNCILATNT
STIDLHLIGQKTSCQDRIAGAHFFSPAHAMPLLEIIRTHRTSSQVVIDLLNVAKQIRKTP
IVVGNCTGFAVNRMFFPFTQVAYFLVDYGLDVYHIDHVITKFGMPMGPFRLADLVGFGVA
IASRKQYLQSYPERCYKSMLIQIMLEENRTGESSRKGFYLYDDKRKASPDPEMNKYIEKS
RSMASIVQDPKLPKLTDDEIVEMMLFPVVNEACRLLDEGVAMKASDLDVASIMGRGFPSY
RGGVMFWADSFGAKYIYDRLKDWSKYHGGIFEPYEYLSTRARQGLSLAAMADGAMSRL
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggcgagaggctccacctccgtggaggtccgccgcgacggcgtcgccgtcatcaccgtc
tccaacccccccgtgaacgcgctctccctcgacgtgatagccagcttgcagagagattat
ggggaagctctgaggaggagtgatgtcaaggcaattgttctcactggcgccaaagggagg
ttttctggaggctttgatataaacgcattcgacaagaagccaaaaaatgagaagcctgga
tatctgtctattgattttttaacggacatagtagaagatgctccgaaaccatcagtggct
gctatagatggcgttgctctaggtggcggcttagagcttgtaatggtttgtcacgctcgt
gtttctacatcttcggctcaattaggattacctgaacttcaactgggcatcattcctggg
ttgggaggaacacaacgactgccccgccttgttggcctgccaaaagctcttgagatgttg
ttgatgtctaaacctctaaaaggagtggaggcacataaatttggtttagttgacgctgta
gtttcagctgatgaattgatcagcacggcctgttcctgggctctggaaattgttgaagac
aaacgcccatggttcaggagtctccatagaaccgatagacttccagctcttgaggaaacg
aagaaaattctgaattttgcaagagttcaggcccaaaagcagtctgctagtctccaacat
cccttagtttgcattgatgtcattgaggagggcataatttctggccctcgagctggccta
atgaaggaaacactttgtggaaaaatgcttgagatgtctcagataagcaaaagcttaagg
catgtcttttttgcacaacgtgcaacttcaaagattccaaatatcagcatattggggttg
acaccacggagaatacacaaggtggctattgttgggggaggtctaatgggatctggaata
gcaactgcattgatatcgaacaacctcctggtaatcctgaaagaagtcaatgagcagttc
ttagatgctggtattagcagagttaaagctaatctgcagagcttagtcaaaagggggcaa
atgaccaaagaagattatgaaaataaactttctttactatctggtgttcttgactatgaa
caatttagagaagctgatgtggtcattgaggcagttattgaggatttatcactaaagcag
aaaatatttgctgaccttgaaaaatactgccactctaattgcatacttgccacgaatact
tcaacaatagaccttcatttaattggccaaaagacatcttgccaggatcgaattgctggt
gcacacttcttcagtccagcccatgcaatgccactgttggaaataatccgtactcatcgg
acttcctcacaagttgtcattgacttgctaaacgtggcaaaacagatacgaaaaacacca
atagttgttgggaactgcacaggttttgctgtgaatcggatgttctttcctttcacacag
gtggcttattttcttgttgattatggtctggatgtctaccacatagaccatgtgattaca
aagtttggaatgccaatgggacctttccgattagctgatcttgttggttttggagttgct
attgcctccagaaagcaatatctccaaagttatcctgagcgatgttacaagtcaatgctt
attcaaattatgcttgaggaaaacaggacaggtgaatcttcacgcaaaggattttatctt
tatgatgataagcgaaaggcttctccagatcctgaaatgaacaagtacattgagaaatca
agaagcatggctagtattgtacaagatcctaagctgccgaaattaacagatgatgaaatc
gtggagatgatgctcttccccgtggtgaatgaggcctgtcgactgcttgacgagggggtt
gctatgaaagcatctgatcttgatgtagcatccattatggggaggggcttcccttcctac
aggggcggagtgatgttctgggccgattcgtttggcgcgaaatacatttacgacagactg
aaggattggtccaagtatcacggagggatctttgaaccctatgaatatttatcaacaaga
gctcgtcagggtttgtctctggccgccatggctgatggtgcaatgtcacggctctag

DBGET integrated database retrieval system