KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326521
Entry
4326521           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase subunit 4, mitochondrial
  KO
K25801  succinate dehydrogenase (ubiquinone) subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4326521
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4326521
SSDB
Other DBs
NCBI-GeneID: 4326521
NCBI-ProteinID: XP_015619484
UniProt: Q942X4
LinkDB
Position
1:complement(41085909..41088163)
AA seq 211 aa
MASRLLARSKALALALSRADAAAPGPAAGVQWLRTLSSLPRDPAAAASPAPAPRQPAVGS
PLGLSKIPGYEQTSRLSGTQVLPRWFSTGTSNGSSAQQEGATRKVMAFSPLEASIAKPRK
GPLTSESWKVKQTELLTRSTYYMIPTLLLVSKNSISTSLLVASVFHQVYMFYKEILLDYV
HHDITRKWVFIYFKILLIIMAKETVVYFDLF
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcgtcgcgcctcctcgcccgatccaaagccctagcgctcgccctgtcccgcgccgac
gcggcggcgccggggcccgccgccggagtgcagtggctccgcacgctgtcctccctcccc
cgcgatccggccgccgccgcctcccccgcccccgcgccgcgccaacccgccgtggggtcc
cctctcggcctctccaagattccaggatatgaacagacatctcgactcagtggtacacaa
gtattgcctcgttggttttctactggaacatcaaatggatcttctgctcagcaggaggga
gccaccagaaaggtaatggcattcagcccattagaagcaagcatcgccaaacccagaaaa
ggtccattgacatctgaaagctggaaagtgaagcagacagagctactaacacgatctacg
tattacatgatcccaactctgcttcttgtatcaaagaacagcatcagtacgtctcttctg
gtcgcatcagtattccatcaagtctacatgttctacaaggagatccttctggactatgtc
catcacgatatcaccaggaagtgggttttcatatacttcaagattctcctgataatcatg
gccaaggaaacagttgtctacttcgatttattttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328125
Entry
4328125           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase subunit 3-1, mitochondrial
  KO
K00236  succinate dehydrogenase (ubiquinone) cytochrome b560 subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4328125
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4328125
SSDB
Motif
Pfam: Sdh_cyt
Other DBs
NCBI-GeneID: 4328125
NCBI-ProteinID: XP_015626313
UniProt: Q6ZH92
LinkDB
Position
2:1151810..1154278
AA seq 129 aa
MEKYHSNSRFAPFRDAPFALRGALGSSGSSFSSIDSLRRSSTLEQARGYTSRPLGAVRPK
MLPSGCRPLHTSHPLSAPVANRPLSPHLPLKKPQLSATFSISHRIFGAALGAAIISIPLA
TKFSLMFDV
NT seq 390 nt   +upstreamnt  +downstreamnt
atggagaagtatcacagcaactcccgatttgctcccttcagagatgctccatttgctctc
cgtggtgcccttggtagctcaggctcatctttcagcagcatcgacagcctcagacgctcc
tcaacccttgagcaagctagggggtacacatctcgtcccctaggagctgtgcggccaaag
atgctcccatctggatgccgacccctgcacacaagccatcctctgtcggctcctgttgct
aaccgccccctgtcaccccaccttcctctgaagaagccacagctgagtgctacattctct
atctcgcaccgtatatttggtgctgcgttgggtgctgccattatatccattcctctcgcc
accaagttcagcctcatgtttgatgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338591
Entry
4338591           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase subunit 4, mitochondrial-like
  KO
K25801  succinate dehydrogenase (ubiquinone) subunit 4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4338591
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4338591
SSDB
Motif
Pfam: CybS Ribosomal_L22
Other DBs
NCBI-GeneID: 4338591
NCBI-ProteinID: XP_015637812
UniProt: B9FP86 Q6I5Q7
LinkDB
Position
5:complement(17914293..17917830)
AA seq 200 aa
MASRLVARSRRGLALALSRAGAGAPSRPSPPGLGKTLGYEPTSHLHGAQFLPCWFSTIAS
NGSHMQKAQETCKPVAGMEHSDALKVMEGTSPKVVAFSPLEAAITKPRSSPLTIESSKVK
RSEIATLVTFYMIPSLLVSSKNGLATSILVGAVFHQIYMFHKEIFLDYVHHDITRKWALI
YFKLLLLIMAKETIVYFNFI
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcgtcgcgactcgtggcccggtcgaggagaggcctagcgctcgccctctcccgcgcc
ggcgccggcgccccgtcgcggccctcccctcctggcctcggcaagactctggggtatgag
ccaacatcacatctccatggtgctcagtttttaccttgttggttttcaactattgcatct
aatggatctcacatgcaaaaggcacaggagacatgtaagccagttgctggaatggaacac
tctgatgcactgaaagtaatggaaggaacctctcctaaagttgtggcattcagcccacta
gaagcagctatcactaaacctagaagcagtcccttgacaattgaaagttctaaagtaaag
cgatcagagattgcaacgctagtcacattttacatgatcccttctctgcttgtttcctca
aaaaatgggcttgctacctctattttggttggcgcagtattccatcaaatatacatgttt
cacaaggagatatttctggactatgtgcaccatgatatcaccaggaagtgggctttgata
tacttcaagctgcttttgttgatcatggcgaaggaaaccattgtgtatttcaactttatc
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342350
Entry
4342350           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4342350
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4342350
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     4342350
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like
Other DBs
NCBI-GeneID: 4342350
NCBI-ProteinID: XP_015646992
UniProt: Q6ZDY8
LinkDB
Position
7:complement(1860674..1866551)
AA seq 630 aa
MWRGCVSRGLRSLSKGKGSSSSAPVSAAARLFSTASSSYTVVDHSYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DSIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRT
GHAMLHTLYGQAMKHNTQFFVEYFALDLIMDSEGTCQGVIALNMEDGTLHRFRATNTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTMKGDNPDSVVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAETAKPGEKQKPLQKSAGEKTIA
WLDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLITKAWESYHDVKISDR
SLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEQWMKHSLGYWE
NEKVRLAYRPVHMNTLDSEVESFPPKARVY
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgtggcgcggctgcgtctcgcgtggcctcaggagcctctccaagggcaagggctcctcc
tcctccgcccccgtctccgccgccgctaggctcttctccaccgcctcgtcgtcgtacacg
gtggtggatcactcgtatgacgcggtcgtggtgggagccggcggcgcggggctccgtgcg
gcgatcgggctctccgagcacgggttcaacacggcttgcatcaccaagctcttccccacg
cggtcgcacaccgtcgcggcgcagggtggcataaatgctgctcttggaaacatgacggaa
gatgactggagatggcatatgtatgacactgtcaagggtagtgattggcttggtgaccag
gattctattcagtatatgtgcagagaagcaccaaaagcagttatagaacttgaaaactat
gggttgccattttcaagaactgaagatggaaagatataccaacgggcctttggaggccag
agcttagattttgggaaaggtgggcaggcctatcgatgtgcatgtgctgctgacagaaca
ggacatgctatgttacacactctgtatggtcaagcaatgaagcataatactcagttcttt
gtagaatattttgcgctagaccttatcatggacagtgaaggcacctgtcagggggttatt
gctttgaacatggaggatggcactcttcaccgtttccgtgctacaaatacaattctggcc
acaggaggttatggcagagcctacttctcagcaacctcagctcacacatgcactggagat
ggcaacgctatggttgcacgtgctggtttaccacttcaggaccttgagtttgtgcagttc
catcctacaggcatttatggtgctggatgccttatcactgaaggttcccgtggtgaaggt
ggtatccttaggaacagtgaaggcgagcgtttcatggaacgatatgctcctactgcaaaa
gatcttgcttctcgagatgttgtttcaagatctatgacaatggaaatcagagaaggccgt
ggtgttgggccattgaaggaccacatctatctgcatcttaaccatctgcctccagaagtt
cttaaggagaggcttcctggtatttctgaaactgctgctatttttgctggtgttgatgtc
accaaggagcccattcctgtcttgcctactgtgcactataatatgggtgggatcccaaca
aattaccatggagaggtagtgactatgaagggtgacaatcctgattctgttgttcctggt
ttgatggctgcgggagaagcagcatgtgcatctgttcatggtgcaaatcgtctgggtgca
aattcacttcttgacatagttgtttttggcagagcttgtgcaaacagggtagctgaaacc
gctaagccaggtgagaagcagaaacctcttcaaaaaagtgctggagaaaagaccatagcc
tggttagacaagctgagaaatgcaaatggatcattgccaacttccaagatccgtctaaac
atgcaacgtgttatgcaaaataatgctgctgtcttccgtacgcaagaaacactcgaggaa
ggttgcaaattgattaccaaggcatgggaaagttatcatgatgtgaagatcagtgaccgg
agtctcatatggaattcagatttgatagagaccattgagttggaaaatctcttgataaat
gcatgcataaccatgcactcagcagaggctcggaaggaaagcagaggagctcatgctcgt
gaagatttcacgaaaagagatgatgagcaatggatgaagcactcgctggggtactgggag
aatgagaaggttcgcttggcatacaggccagtccacatgaacacattggacagtgaagtt
gagtcgttcccacccaaggcgcgtgtttattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343404
Entry
4343404           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase subunit 3-2, mitochondrial
  KO
K00236  succinate dehydrogenase (ubiquinone) cytochrome b560 subunit
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4343404
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4343404
SSDB
Motif
Pfam: Sdh_cyt
Other DBs
NCBI-GeneID: 4343404
NCBI-ProteinID: XP_015647541
UniProt: Q84VK7
LinkDB
Position
7:20127002..20128839
AA seq 129 aa
MEKYQSKARFAPLSDAPFALRGALGSSNSSFNNIDHLRQSSSSGQARSYTSSPLGALRPK
MFPSGNRLLHTSRPLSAPVANRPLSPHLPLKKPQLSATFSISHRIFGAALGAVIISIPLA
TKFSLMFDV
NT seq 390 nt   +upstreamnt  +downstreamnt
atggagaagtaccagagcaaggcccggtttgcacccctcagtgatgctccatttgctctc
cgcggtgcccttggtagctcaaactcatccttcaacaacatagatcatctgagacaatcc
tcaagttctggacaagctaggagctacacatcttcacccctaggagctctgagaccaaag
atgttcccatctggaaaccgactcctgcacacaagtcgtcccctgtcggctcctgttgca
aaccgcccactgtcaccccatctccctttgaagaagccgcagctgagtgctacgttctca
atctcacaccgtatttttggtgctgccctgggagctgtcattatatccattcctcttgcc
accaaattcagcctcatgtttgatgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344541
Entry
4344541           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 1, mitochondrial isoform X2
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4344541
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4344541
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     4344541
SSDB
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_9
Other DBs
NCBI-GeneID: 4344541
NCBI-ProteinID: XP_015650211
UniProt: Q9S827
LinkDB
Position
8:complement(1091207..1094685)
AA seq 281 aa
MAAAALLRRSPAARALLSPALSSRLVASKPHSSSPAPPPPPSKAGANTKTFSIYRWDPDS
PSTKPHLKDYKVDLSDCGPMVLDVLLKIKNEQDPSLTFRRSCREGICGSCAMNIDGDNGL
ACLTKISSASSASTISPLPHMFVIKDLVVDMTNFYNQYKSVEPWLKRKDAPPQPGKEIPQ
TKADRAKLDGMYECILCACCSTSCPSYWWNPEEYLGPAALLHANRWIQDSRDQFTKERLD
SINDEFKLYRCHTIKNCTHACPKGLNPAKHIDTIKKLQLEA
NT seq 846 nt   +upstreamnt  +downstreamnt
atggccgccgccgccctcctccgccgctcgccggcggcgcgcgccctcctctccccggcg
ctctcctcccgcctcgtcgcctccaagccccactcgtcgtcccccgcgccgccgccgccg
ccgtcgaaggcgggggcgaacaccaagacgttctcgatctacaggtgggatcccgactcg
ccgtcgacgaagccccacctcaaggactacaaggtggacctctccgactgcgggccgatg
gtgctcgacgtgctgctcaagatcaagaacgagcaggacccgtcgctcaccttccgccgc
agctgccgcgaggggatctgcgggagctgcgcgatgaacatcgacggcgacaatggcctc
gcctgcctcaccaagatctcgtcggcgtcctcggcctccacgatctcgccgctcccccac
atgttcgtcatcaaggacctcgtcgtcgacatgaccaacttctacaaccagtacaagagc
gtggagccgtggctcaagcgcaaggacgcgccgccgcagcccgggaaggagatcccgcag
accaaggccgaccgcgccaagctcgacggcatgtacgagtgcatcctctgcgcctgctgc
tccacctcctgcccctcctactggtggaaccccgaggagtacctcggccccgccgcgctc
ctccacgccaacaggtggatacaggacagccgtgaccagttcactaaggagcgcctggat
tccatcaacgacgagttcaagctgtaccgctgccacaccatcaagaactgcacacacgcc
tgccccaagggcctcaacccagcgaagcacatcgacacaatcaagaagctccagctcgag
gcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346890
Entry
4346890           CDS       T01015                                 
Name
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa00190  Oxidative phosphorylation
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
osa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4346890
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4346890
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     4346890
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_18 Fer4_7 Fer4_16
Other DBs
NCBI-GeneID: 4346890
NCBI-ProteinID: XP_015611366
UniProt: Q6H4G3
LinkDB
Position
9:complement(12295665..12296751)
AA seq 311 aa
MILRRTLPRLASAKDGSGGGFADGHFPSLRGHPAARANARDAAEKQAALAAKEEEIRDHR
RGDAAAASPAPSTVKEFRVYRWSPDAPSRRPHLQSYHVDLATCGPMVLDVLQKIKAEHDA
TLAFRRSCREGICGSCSMCIDGVNTVACLRPVDTDTSSATTVTPLPHMYVVRDLVVDLTS
FYQQYKSVEPWLKRKTKTKTETTEHAQSPEERKRLDGLYECILCACCSAACPSYWWNAEA
FLGPAALLHAYRWVSDSRDEYAAERVQALAEGWDKLYRCRMIKSCTATCPKSLDPAAAIS
AMKTLHQLGKP
NT seq 936 nt   +upstreamnt  +downstreamnt
atgattctgcggaggacgctgccgaggctggcctcggcgaaggacggcagcggcggcggc
ttcgccgacggccacttcccctccctccgcggccaccccgccgcgcgcgccaacgcgcgg
gacgccgccgagaagcaggcggcgctggctgcgaaggaggaggagatcagggaccaccgg
cgcggcgacgccgcggcggcgtcgccggcgccgtcgacggtgaaggagttccgggtgtac
cggtggagcccggacgccccctcgcggcggccgcacctgcagtcgtaccacgtcgacctc
gccacatgcggtcccatggtgctggacgtcctgcagaagatcaaggcggagcacgacgcg
acgctggcgttccggcggtcgtgccgggagggcatctgcgggtcgtgctccatgtgcatc
gacggggtgaacaccgtggcgtgcctcaggcccgtggacaccgacacctcgtcggccacg
acggtgacgccgctgccccacatgtacgtcgtgagggacctcgtcgtcgacctgaccagc
ttctaccagcagtacaagtcggtggagccgtggctgaagaggaagacgaagacgaagacg
gagacgacggagcacgcgcagtcgccggaggagaggaagaggctggacgggctgtacgag
tgcattctgtgcgcgtgctgcagcgcggcgtgcccgtcctactggtggaacgcggaggcg
ttcctggggccggcggcgctgctgcacgcgtaccggtgggtgtcggacagccgcgacgag
tacgcggcggagcgggtgcaggcgctggcggaggggtgggacaagctctaccgctgccgg
atgatcaagagctgcacggccacctgccccaagagcctcgaccccgccgccgccatctcc
gccatgaagaccctgcaccagctcggcaagccatga

DBGET integrated database retrieval system