KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326551
Entry
4326551           CDS       T01015                                 
Name
(RefSeq) tryptophan--tRNA ligase, chloroplastic/mitochondrial isoform X1
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4326551
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4326551
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4326551
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     4326551
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   4326551
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4326551
 Prokaryotic type
    4326551
SSDB
Motif
Pfam: tRNA-synt_1b
Other DBs
NCBI-GeneID: 4326551
NCBI-ProteinID: XP_015614072
UniProt: A0A0P0V819
LinkDB
Position
1:complement(31070176..31076301)
AA seq 399 aa
MSRTLLSHILHRPPPLLASRGGGRGGALPSRLRTLRLNCSVAEATASGDEAPAPPARKKR
VVSGVQPTGLVHLGNYLGAIKNWVSLQDLYETLFFIVDLHAITLPYEAPQLSKATRSTAA
IYLACGIDSSKASIFVQSHVRAHVELMWLLSSSTPIGWLNRMIQFKEKSRKAGDENVGVA
LLTYPVLMASDILLYQSDLVPVGEDQTQHLELTREIAERVNNLYGGRKWKKMGGRGGSLF
KVPEALIPPAGARVMSLTDGLSKMSKSAPSDQSRINLLDPKDVIMNKIKRCKTDSFPGLE
FDNPERPECNNLLSIYQIITGKTKEEVIRECENMNWGSFKTTLTDALIDHLQPIQVRYEE
IMSDPGYLDGVLLEGSGKAAEIADITLNNVYQAMGFLRR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgagccgcacgctcctctcccacatcctccaccgcccgccgccgctcctcgcgtcgagg
ggtggtgggcgaggaggagcgctcccgtcccgcctccgcactctccgactcaactgcagc
gtggctgaagcgactgcctccggcgacgaggcgcctgctcctccggctaggaagaaaaga
gtagtttctggtgtacagccaacaggattggtacaccttggaaattatcttggtgctatt
aagaattgggtttcacttcaggatctatacgagacattatttttcattgtggacttgcat
gcgattacgttaccatatgaagcaccacagttgtcaaaagcaacaagaagcactgctgca
atatatctggcttgtggcattgacagttcaaaggcttctatatttgtacagtctcatgtc
cgtgctcatgttgagttgatgtggcttctgagttcttctactcctattggttggctcaac
agaatgatccaattcaaagagaagtcacgcaaggcgggtgatgaaaatgttggagtggca
cttttgacttatcctgttttaatggcttctgacattctcctgtaccagtccgatctggtg
cctgttggtgaagatcagacacaacatttggaattaactcgcgaaatcgctgagcgtgta
aataatctatacggtggaaggaaatggaagaaaatgggagggagaggtggttcactattt
aaggttcctgaagcccttatacctccagcaggggctcgtgttatgtccttaaccgacggt
ctctccaagatgtcgaagtctgctccttcagatcagtctcgtattaaccttcttgatcca
aaagatgttatcatgaataagattaagcgctgcaaaactgactcgttcccaggcttggaa
tttgacaacccagagaggcctgaatgcaacaatcttctctcgatctaccagattattaca
gggaaaactaaagaggaagttatcagagaatgcgaaaatatgaactgggggtcgttcaaa
acaactcttacagatgcattgattgatcatctgcaacctatccaggtccgctacgaggag
ataatgtctgatcctggttatttggatggtgttctcttagaaggatcaggaaaagctgct
gagatagcagacatcaccctcaacaacgtataccaagccatgggtttcttgcgcagatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352435
Entry
4352435           CDS       T01015                                 
Name
(RefSeq) tryptophan--tRNA ligase, cytoplasmic
  KO
K01867  tryptophanyl-tRNA synthetase [EC:6.1.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    4352435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:osa01007]
    4352435
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:osa03016]
    4352435
Enzymes [BR:osa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.2  tryptophan---tRNA ligase
     4352435
Amino acid related enzymes [BR:osa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   4352435
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    4352435
 Prokaryotic type
    4352435
SSDB
Motif
Pfam: tRNA-synt_1b
Other DBs
NCBI-GeneID: 4352435
NCBI-ProteinID: XP_015620246
UniProt: Q2QP62 Q0IMU5
LinkDB
Position
12:complement(21625453..21629702)
AA seq 408 aa
MAAAAEAVTEVDATNEEGEEEEQVVNPWEVSAGKGGIDYDKLVDQFGCQRLDDALVARVA
RLTARPPHRFLRRGLFFAHRDLNEILDLYEKGEKFYLYTGRGPSSEALHLGHLIPFMFTK
YLQDAFKVPLVIQLTDDEKFLWKNLTVEETKRLARENAKDIIACGFDVERTFIFSDFNYV
GGAFYENMVKVARCVTYNKVVGIFGFTPEDHIGKVSFPPVQAVPSFPSSFPHLFSGNDQL
RCLIPCAIDQDPYFRMTRDVAPRIGYQKPSLIESRFFPALQGENTKMSASDPNSAIYVTD
SAKEIKTKVNKYAFSGGRDSIELHRKLGANLDVDVPIKYLNFFLEDDNELEHIKKEYKEG
RMLTGEVKQRLVAVLSELVARHQRARALVTEEMVDVFMAARPLPNMFG
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcagcggcagcggaggccgtgaccgaggtggatgccacgaacgaggagggggaggag
gaggagcaggtggtgaacccgtgggaggtgtcggcggggaaaggcgggatcgactacgac
aagctcgtcgaccagttcggctgccagcgcctcgacgacgcgctcgtcgcccgcgtcgcc
cgcctcaccgcccgcccccctcaccgcttcctccgccgcggcctcttcttcgcccaccgg
gatttgaacgagatactggatttgtacgagaagggggagaagttctacctctacacgggg
agggggccctcgtcggaggcgctgcacctcggccatctcatccccttcatgttcaccaaa
tatctgcaggatgctttcaaggtgcccctagtaatacagctaactgatgatgagaagttc
ttatggaagaatttgactgttgaggaaactaaaaggcttgcccgtgaaaatgcaaaagat
atcattgcttgtggatttgatgtcgaaaggactttcattttctctgattttaattatgtt
ggaggtgctttttatgaaaacatggttaaagttgccagatgtgtgacatataataaggtt
gttggaatatttggattcaccccagaggatcatataggaaaagtcagctttcctcctgtg
caagcggttccatcattcccttcttcatttccacatctcttctctgggaatgaccaacta
cggtgcttaatcccatgtgcaatagaccaggatccttatttcaggatgacccgggacgtt
gctccaagaattggttaccagaaaccatcattaattgaatcgagatttttccctgctctt
cagggggagaacacaaaaatgtcggccagtgatccaaattctgcaatatatgtgacagat
agtgctaaagaaataaagacaaaggtgaacaaatatgcgttctcaggtggccgggactca
attgagctccatagaaaacttggagctaaccttgatgtggatgttccaatcaagtacctg
aacttcttccttgaagatgacaatgagctcgagcacataaagaaggagtacaaggaagga
aggatgctgacgggtgaagtgaagcagcgccttgttgcagttctatccgaactggttgcg
agacatcaaagagctagagcactagtgaccgaggagatggtcgatgtatttatggcggcg
agacctcttcccaatatgtttggctga

DBGET integrated database retrieval system