KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326555
Entry
4326555           CDS       T01015                                 
Name
(RefSeq) HD domain-containing protein 2 homolog
  KO
K07023  5'-deoxynucleotidase [EC:3.1.3.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4326555
   00240 Pyrimidine metabolism
    4326555
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.89  5'-deoxynucleotidase
     4326555
SSDB
Motif
Pfam: HD_3 YfbR-like HD Lsm_C
Other DBs
NCBI-GeneID: 4326555
NCBI-ProteinID: XP_015622465
UniProt: B7FAI0
LinkDB
Position
1:25762439..25766446
AA seq 265 aa
MGVTTRLPAPPGGGLQRRAPRGILPASLPVERPARRRLAPGVRAASGIPGPGGSPVPRRT
TPAPADAAAAAPPSAAASSASSAIDFLTLCHRLKTTKRKGWINHSIKGPESIADHMYRMA
LMALIAGDLPAVDRERCIKIAIVHDIAEAIVGDITPSDGIPKAEKSRREQKALNEMCEVL
GGGPIADEIKELWEEYENNSSIEANLVKDFDKVEMILQALEYEKEHGKVLDEFFLSTAGK
FQTEIGKSWAAEVNARREQRCGKQK
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggcgtgaccacgcggctgccggcccctccagggggcggcctccagcgccgcgcgccg
cggggcatcctcccggcctcgctccccgtggagcgcccggcgcggcgccgcctcgcgccc
ggcgtccgcgccgcctccgggatccctggacccggcggatcgcccgtccctaggcggacg
acgcctgcgccggccgacgcggccgccgcggcgccgccctccgccgcggcgtcgtctgcc
tcctcggccatcgatttcctcaccctctgccatcgccttaagaccactaaaaggaaaggc
tggataaaccatagcataaagggtcctgagtctattgctgatcacatgtaccgtatggcc
cttatggctttgattgccggtgacctacctgctgtagatcgagaaagatgcatcaaaatt
gctatcgtgcatgacattgctgaagctattgttggtgacattactccatccgacggtata
cctaaagcggaaaaaagccgccgtgaacaaaaggctctaaatgaaatgtgtgaagttctc
ggtggaggaccaatagctgatgagatcaaggagctctgggaagaatatgaaaataattca
tccattgaagccaaccttgtaaaggattttgataaagtggaaatgatacttcaagcacta
gaatatgagaaagagcatggcaaagtgttagatgagttcttcctctctaccgctggcaag
ttccagacagagattggcaagagctgggctgctgaagtgaatgcgaggagagaacagaga
tgcggaaaacagaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327823
Entry
4327823           CDS       T01015                                 
Name
(RefSeq) 5'-nucleotidase SurE
  KO
K03787  5'/3'-nucleotidase [EC:3.1.3.5 3.1.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa00760  Nicotinate and nicotinamide metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4327823
   00240 Pyrimidine metabolism
    4327823
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4327823
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     4327823
    3.1.3.6  3'-nucleotidase
     4327823
SSDB
Motif
Pfam: SurE
Other DBs
NCBI-GeneID: 4327823
NCBI-ProteinID: XP_015617688
UniProt: Q0JJY1 A0A0P0V787
LinkDB
Position
1:29479113..29482677
AA seq 418 aa
MAASSGDDAPRPNPLPSALVSNLQSVLAARRPPPPAAEEAGAEAPAPEAAESSGAAPVAD
EGPAKPAVLLTCAGGIRAPGLAALVDSLVAGGRCDVHVCAPESDKPACGYSITIRETITA
TSVDFKGAKAFEISGTPVDCVSLALSGRLFSWSAPALVISGINAGANCGYEMFHSSAIAA
AREALLYDVPSIAISLNWKKDESKDSDFKDAAEVCLPLIHAALEGVEKGTFLRGCLLNIG
VPSSPTTNKGFKLTKQSIYRPAQSWEGVSTSRPTPATHFMGMHQSLGIQLAQLGKDASAA
GAARRINAQRKIVEVESVASTGKAEAREVVKKLFRAEFTEKQHECLDEDIDLRALENGFI
SVTPLNIHGNVAPETGAPASDWLSVAVGLDKAKEDSVVTAEEQDAPAVAEEKEAPSAT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggccgcgagctccggcgacgacgcgccgaggcccaatccgctcccgtccgcgctcgtg
tccaacctgcagtccgtcctcgcggcgcgccggccgccgccgccggccgcggaggaggcc
ggcgccgaggccccggcaccggaggcggcggagtcctccggcgctgctcccgtggccgat
gaaggtcccgcgaagccggccgtactcctgacctgcgccggcgggatccgggcgccgggt
ctcgcggccctcgtcgactccctcgtcgccggcggccgatgcgacgtccacgtatgcgcg
cccgaatcggacaagcctgcttgcggctattccattaccatccgcgagaccattacagca
acatcggtggatttcaaaggggcgaaagctttcgagatatcagggacaccggtggattgc
gtctctttggcattatctgggaggctgttctcttggtcggcgcctgctttggtgatcagt
gggatcaatgcaggggcgaactgtggatatgagatgtttcattcttctgccattgctgct
gcaagggaggccttactgtatgatgttccttcaattgcaatatcattgaattggaagaag
gatgaaagcaaagatagtgatttcaaggatgctgctgaggtttgcctaccattgatacac
gctgccttggaaggcgttgagaaaggaaccttcctcagaggctgcttactgaacattggg
gttccaagctcaccaactacaaataagggtttcaagctgactaagcaaagcatatatcgt
cctgcccaaagttgggaaggtgtgtccacaagcagacctacacctgctactcacttcatg
ggcatgcaccaaagccttggtattcagctcgcacaacttgggaaggatgcatctgcagca
ggggctgcacgcagaattaatgctcagcggaagattgtcgaggttgagtctgttgcatct
acagggaaagcagaggctcgagaagtagtgaagaagcttttccgtgctgagttcactgaa
aagcagcatgaatgcttagacgaggatatcgatttgagagctttggagaatggatttata
tctgtcactcctctgaatatacacggaaatgtggctcctgaaactggagcacctgcttca
gattggctctcggtagctgtgggtctagacaaagcaaaggaagattctgtagttacagca
gaagaacaagatgctccagctgtagctgaggaaaaggaagctccttcagcaacctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328498
Entry
4328498           CDS       T01015                                 
Name
(RefSeq) HD domain-containing protein 2
  KO
K07023  5'-deoxynucleotidase [EC:3.1.3.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4328498
   00240 Pyrimidine metabolism
    4328498
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.89  5'-deoxynucleotidase
     4328498
SSDB
Motif
Pfam: HD_3 YfbR-like HD
Other DBs
NCBI-GeneID: 4328498
NCBI-ProteinID: XP_015623548
UniProt: Q0E3E3 Q6ETL6
LinkDB
Position
2:4384170..4388015
AA seq 228 aa
MGGSRALPLSSLLAAATKSPLLHHRPLPLRLAASMSSSSPSPSPAAPASASAIDFLTLCY
RLKTTKRAGWVRRGVQGPESVADHMYRMGVMALVAADLPSGVNRDRCVKMAIVHDIAEAI
VGDITPSDGVPKEEKSRREQEALDHMCSLLGGGPRAEEIRELWMEYEQNATLEAKVVKDF
DKVEMILQALEYEKEQGLDLEEFFQSTAGKFQTDVGKAWAAEVASRRK
NT seq 687 nt   +upstreamnt  +downstreamnt
atgggtgggagccgagcccttcccctctcctccctcctcgccgccgccaccaaatccccc
ctcctccaccaccgccccctcccgctccgcctcgccgcctccatgtcgtcgtcgtcccct
tccccctctcccgctgctccggcctccgcctccgccatcgacttcctcacgctctgctac
cgcctcaagacgacgaagagggccgggtgggtgaggcgcggggtgcaggggccggagtcc
gtcgccgaccacatgtaccggatgggcgtcatggcgctcgtcgccgccgacctgcccagc
ggcgtgaaccgcgacaggtgtgtcaagatggcgatcgtgcacgacatagccgaagctatt
gttggtgatatcaccccttcagatggcgtgccgaaggaagaaaagagccgcagagagcaa
gaagcattggaccatatgtgcagtttgctcggtggtggtccgagagctgaagaaatccgt
gaactttggatggaatatgagcagaatgccactttggaagcaaaggttgtgaaagatttt
gacaaggttgagatgattcttcaagcattggagtatgaaaaggagcaagggctggaccta
gaagagtttttccagtcaacagcagggaaatttcagacagacgttggaaaagcatgggca
gcagaggtagcatcaagaagaaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342678
Entry
4342678           CDS       T01015                                 
Name
(RefSeq) 5'-nucleotidase SurE isoform X1
  KO
K03787  5'/3'-nucleotidase [EC:3.1.3.5 3.1.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa00760  Nicotinate and nicotinamide metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4342678
   00240 Pyrimidine metabolism
    4342678
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4342678
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     4342678
    3.1.3.6  3'-nucleotidase
     4342678
SSDB
Motif
Pfam: SurE TraW_N CreA
Other DBs
NCBI-GeneID: 4342678
NCBI-ProteinID: XP_015647703
LinkDB
Position
7:complement(5613818..5623722)
AA seq 312 aa
MDSSAASAAAAAAAPVVLVTNDDGIDAPGLRFLVGQLVAARRYRVLVCAPDTDRSGVSHS
ITWRPALRCKRVDIDGATAFAASGTPADCASLGISGKLFDGLVPDLVVSGINVGNNCGCH
VIYSGTVGGAREAFLYGIPSLAMSYDWVASQSSVNDLKVAAEVVMPLINNVMAEIKNGTY
PQGSFLNIDIPTDAAHHKGYKITKQGRYMARIGWEQTVYKKPAVESYQTANMDVDSEKDS
EVDTSSENDLLFKRVLVRRSYDEEEGDDIDHKCLVDGYITVTPLGALSRAEADVIPYYKA
CLSRDQDTFVAH
NT seq 939 nt   +upstreamnt  +downstreamnt
atggactcctccgcggcgtcggcggcggctgcggcggcggcgccggtggtgctggtgacg
aacgacgacggcatcgacgcgccgggactccgcttcctcgtcggccagctcgtcgccgcc
cgccgctaccgcgtcctcgtctgcgcgcccgacacagacaggtcaggtgttagccactcc
atcacatggcgccctgcactccgctgtaaacgagttgatatagatggtgctacagcattt
gcagcctcagggactcctgctgactgtgcttctttaggcatatctgggaagctctttgat
ggtttggttcctgatctggtagtcagtggaatcaatgttggcaacaattgtggatgccat
gttatctattctggaacagttggcggtgctagggaggcattcttgtacgggattccttca
ttagccatgtcatatgattgggtcgcaagtcagagcagtgttaacgacctcaaagtagct
gcagaggttgttatgcctctgataaataatgtgatggctgagataaagaatgggacatat
cctcaaggatcattcttgaatatagatataccaactgatgctgcacaccacaagggatac
aaaattacaaagcaaggaaggtatatggccagaattggttgggagcaaacagtttataag
aagcctgcggtagaaagttaccagacagcaaacatggatgttgacagtgaaaaggacagt
gaagtagatacttcatcagagaatgacctattgtttaaaagagtgcttgtgaggcgaagt
tatgatgaagaggaaggggatgatatcgaccacaagtgccttgtagatggatatattact
gttacccctttgggagctctatcccgcgcagaagctgatgtcataccatactacaaagct
tgcttgtcacgtgatcaggatacttttgtggcccactaa

DBGET integrated database retrieval system