KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326555
Entry
4326555           CDS       T01015                                 
Name
(RefSeq) HD domain-containing protein 2 homolog
  KO
K07023  5'-deoxynucleotidase [EC:3.1.3.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4326555
   00240 Pyrimidine metabolism
    4326555
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.89  5'-deoxynucleotidase
     4326555
SSDB
Motif
Pfam: HD_3 YfbR-like HD Lsm_C
Other DBs
NCBI-GeneID: 4326555
NCBI-ProteinID: XP_015622465
UniProt: B7FAI0
LinkDB
Position
1:25762439..25766446
AA seq 265 aa
MGVTTRLPAPPGGGLQRRAPRGILPASLPVERPARRRLAPGVRAASGIPGPGGSPVPRRT
TPAPADAAAAAPPSAAASSASSAIDFLTLCHRLKTTKRKGWINHSIKGPESIADHMYRMA
LMALIAGDLPAVDRERCIKIAIVHDIAEAIVGDITPSDGIPKAEKSRREQKALNEMCEVL
GGGPIADEIKELWEEYENNSSIEANLVKDFDKVEMILQALEYEKEHGKVLDEFFLSTAGK
FQTEIGKSWAAEVNARREQRCGKQK
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggcgtgaccacgcggctgccggcccctccagggggcggcctccagcgccgcgcgccg
cggggcatcctcccggcctcgctccccgtggagcgcccggcgcggcgccgcctcgcgccc
ggcgtccgcgccgcctccgggatccctggacccggcggatcgcccgtccctaggcggacg
acgcctgcgccggccgacgcggccgccgcggcgccgccctccgccgcggcgtcgtctgcc
tcctcggccatcgatttcctcaccctctgccatcgccttaagaccactaaaaggaaaggc
tggataaaccatagcataaagggtcctgagtctattgctgatcacatgtaccgtatggcc
cttatggctttgattgccggtgacctacctgctgtagatcgagaaagatgcatcaaaatt
gctatcgtgcatgacattgctgaagctattgttggtgacattactccatccgacggtata
cctaaagcggaaaaaagccgccgtgaacaaaaggctctaaatgaaatgtgtgaagttctc
ggtggaggaccaatagctgatgagatcaaggagctctgggaagaatatgaaaataattca
tccattgaagccaaccttgtaaaggattttgataaagtggaaatgatacttcaagcacta
gaatatgagaaagagcatggcaaagtgttagatgagttcttcctctctaccgctggcaag
ttccagacagagattggcaagagctgggctgctgaagtgaatgcgaggagagaacagaga
tgcggaaaacagaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328498
Entry
4328498           CDS       T01015                                 
Name
(RefSeq) HD domain-containing protein 2
  KO
K07023  5'-deoxynucleotidase [EC:3.1.3.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00230  Purine metabolism
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    4328498
   00240 Pyrimidine metabolism
    4328498
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.89  5'-deoxynucleotidase
     4328498
SSDB
Motif
Pfam: HD_3 YfbR-like HD
Other DBs
NCBI-GeneID: 4328498
NCBI-ProteinID: XP_015623548
UniProt: Q0E3E3 Q6ETL6
LinkDB
Position
2:4384170..4388015
AA seq 228 aa
MGGSRALPLSSLLAAATKSPLLHHRPLPLRLAASMSSSSPSPSPAAPASASAIDFLTLCY
RLKTTKRAGWVRRGVQGPESVADHMYRMGVMALVAADLPSGVNRDRCVKMAIVHDIAEAI
VGDITPSDGVPKEEKSRREQEALDHMCSLLGGGPRAEEIRELWMEYEQNATLEAKVVKDF
DKVEMILQALEYEKEQGLDLEEFFQSTAGKFQTDVGKAWAAEVASRRK
NT seq 687 nt   +upstreamnt  +downstreamnt
atgggtgggagccgagcccttcccctctcctccctcctcgccgccgccaccaaatccccc
ctcctccaccaccgccccctcccgctccgcctcgccgcctccatgtcgtcgtcgtcccct
tccccctctcccgctgctccggcctccgcctccgccatcgacttcctcacgctctgctac
cgcctcaagacgacgaagagggccgggtgggtgaggcgcggggtgcaggggccggagtcc
gtcgccgaccacatgtaccggatgggcgtcatggcgctcgtcgccgccgacctgcccagc
ggcgtgaaccgcgacaggtgtgtcaagatggcgatcgtgcacgacatagccgaagctatt
gttggtgatatcaccccttcagatggcgtgccgaaggaagaaaagagccgcagagagcaa
gaagcattggaccatatgtgcagtttgctcggtggtggtccgagagctgaagaaatccgt
gaactttggatggaatatgagcagaatgccactttggaagcaaaggttgtgaaagatttt
gacaaggttgagatgattcttcaagcattggagtatgaaaaggagcaagggctggaccta
gaagagtttttccagtcaacagcagggaaatttcagacagacgttggaaaagcatgggca
gcagaggtagcatcaagaagaaagtga

DBGET integrated database retrieval system