KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326560
Entry
4326560           CDS       T01015                                 
Name
(RefSeq) probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2 isoform X1
  KO
K15889  prenylcysteine alpha-carboxyl methylesterase [EC:3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4326560
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4326560
SSDB
Motif
Pfam: BD-FAE Abhydrolase_3 COesterase Peptidase_S9 Hydrolase_4 Abhydrolase_2 DLH Abhydrolase_6 DUF829 Transposase_31
Other DBs
NCBI-GeneID: 4326560
NCBI-ProteinID: XP_015621880
LinkDB
Position
1:25792529..25801211
AA seq 482 aa
MFCPPPPTRPLLPRTTRVLRLFRPHHRHHPPTLPLRRRPPPDHLPHRCELRPTHPPEPIR
ISRTPPQRRAPPAMRPVSSAEEVGALLSRSDSSGRRRRSSPVQSASPRPAGCGCGGPRRQ
SSFRDDVGHAASETYLVTRLTFSLLQYLGLGYRWMSQLLALTIYAILLMPGFLQVGYYYF
FSSQVRRSIVYGEQPRNRLDLYIPKDINRPCPVVAFVTGGAWIIGYKAWGSLLGRRLAER
GIIVACIDYRNFPQGTIGDMVSDASQGISYVCNNIASYGGDPNRIYLVGQSAGAHIAACA
LIEQAVKESSGQSISWSVTQIKAYFGLSGGYNMHSLVDHFHERGLNRSIFFSIMEGEESL
SRYSPEIVVKQSSSQTIALLPPIVLMHGTEDYSIPSSASQTFADVLQQAGAQAKLQLYEG
KTHTDIFIQDPLRGGRDPLVEDVLSIIHVDDEITQEKIALAPAPRRLVFEWQLQLARRFS
PF
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgttttgcccgcctccgcccacgcgtcccttgttgccacgcactacccgagtactccgc
ctatttaggccccaccaccgccaccaccccccaactctccccctccgacggcgtccacca
cccgaccacctcccgcaccgttgcgagttgcgacccacccacccacccgaaccgattcga
atatcccgcacaccgccccagcgccgcgcgccgcccgcaatgcggcccgtctccagcgcc
gaggaggtcggcgcgctcctctcgcggagcgactcctccggccgccgccgccgctcgtcg
ccggtgcagtccgcgtccccgcgacccgccggatgcggctgcggcggcccgaggcggcag
tcctcgttccgcgacgatgtcgggcacgcggcctccgagacgtacctcgtcacgcgcctc
accttcagcctcctgcagtacctcgggttaggttaccggtggatgtcacaactacttgcc
ctgacaatctatgcaattttacttatgccaggttttttgcaagttggatattactatttc
ttctcaagtcaggttcgtagaagtatagtctatggagaacaaccaagaaacaggctagat
ttgtacatacccaaagatatcaacagaccctgcccagtggtggccttcgtaactggtggg
gcttggattattggttacaaggcatggggttcccttcttgggaggcggttggctgagaga
ggaatcatagttgcttgcattgattacagaaatttccctcaaggaacaataggtgacatg
gttagcgatgcttcccagggtatttcttatgtgtgcaacaacattgctagttatggaggt
gatcctaatcggatctacttggtgggtcagtcagcaggagcacatattgctgcatgtgcc
ctcatcgagcaggcagtgaaagaatctagtgggcagtccatttcttggagtgttacacaa
atcaaagcatattttggtttatctggaggatacaacatgcatagtttggttgaccatttt
catgaacgtggtcttaatcgttcaatatttttcagcataatggaaggagaggagtcattg
tcacgttattctccggaaattgttgtcaagcagtcaagttcccagacaatagctcttctg
cctcccattgttcttatgcatggaactgaagattattcaataccatcatctgccagtcaa
acttttgctgacgtccttcaacaagctggtgctcaagccaagttacagttgtacgaaggc
aaaacacatacagatatatttatacaggatcctcttcggggtggaagagatccattggtt
gaagatgtattgtctattattcatgttgatgatgaaattacacaagaaaagattgctctg
gcaccagctccaaggcgcctggtgtttgagtggcaattacagctggcccgtcgatttagt
ccattctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339700
Entry
4339700           CDS       T01015                                 
Name
(RefSeq) probable isoprenylcysteine alpha-carbonyl methylesterase ICME isoform X1
  KO
K15889  prenylcysteine alpha-carboxyl methylesterase [EC:3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4339700
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4339700
SSDB
Motif
Pfam: BD-FAE Abhydrolase_3 COesterase Peptidase_S9 Hydrolase_4 Abhydrolase_6 Abhydrolase_2 DLH
Other DBs
NCBI-GeneID: 4339700
NCBI-ProteinID: XP_015639665
UniProt: Q6L5F5
LinkDB
Position
5:complement(28745108..28751803)
AA seq 414 aa
MQPASPVSGDAGPVAEAVPPRGAPQVLVRRRSVPFSPDSPLAPGSRGGGERRSTFREDVS
HAAAETYLVTRLAFILLRYLGVGYRWISQLAALIIYAILLMPGFIRVGYYYFFSRQVLRS
VIYGDQPRNRLDLYIPRDPKKPSPVVAFVTGGAWIIGYKAWGALLGRRLAERGIIVACID
YRNFPQGTISDMVSDASDGISFVCETVGAYGGDPNQIYLMGQSAGAHIAACALLEQAAKE
SRGEQISWSVTQIKAYFGLSGGYNIENLVDHFHERGLYRSIFLSIMEGKKSLPHFSPETV
AKKLCPETIALLPQIVLLHGTDDYSIPFSASETFAGVLKQAGAKAKLLLYEGKTHTDVFL
QDPLRGGRDKLVEDVISVIHADDADAREKDALAPIPGRLVSEWQIKLAHRISPF
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcagcccgcgagtccggtctccggtgacgcgggccccgtggcggaggcggtacctcca
cgcggtgccccccaggtcctcgtgcgccggcgttccgtgcccttctcccccgactctccg
ctcgcccccggcagccgcgggggcggcgagaggaggtccacgttccgggaggacgtcagc
catgccgccgccgagacgtacctcgtcacgcgcctcgccttcatcctcctccgatacctc
ggggtaggctaccggtggatttctcagctcgctgccctcataatatatgcaattttactt
atgcccggtttcataagagttgggtattattatttcttttcaagacaagttttgaggagc
gtgatctatggggatcaaccaagaaataggttggatctttacataccaagagaccccaaa
aaacccagtccagttgttgcatttgttactggtggtgcatggatcattggttacaaggcg
tggggtgctcttcttggaaggaggttagcagagcgaggaattatagttgcatgcattgat
tacaggaattttcctcaaggaacaataagtgacatggttagcgatgcttctgatgggatt
tcatttgtttgtgagactgttggtgcctatggaggagatcctaatcagatatacttaatg
ggtcaatcagcaggagcacatatcgcagcatgcgctcttttggaacaagcggctaaagaa
tctaggggagagcagatttcatggagtgttactcaaataaaagcatactttggtttgtct
ggaggatacaacattgaaaatttggttgatcatttccatgaacgtggtctttaccgttca
atatttctcagcataatggagggaaagaaatcattgccacatttctctccagaaactgtt
gccaagaaattatgtcctgaaacaatagctcttcttcctcagattgtgcttttgcatgga
acggatgattattctataccattttctgctagtgaaacttttgcgggtgtccttaaacaa
gctggtgctaaagccaagttactactctatgaagggaaaacacatactgatgtattttta
caggatccactaaggggtggcagggacaaactggttgaagacgttatttctgttatccat
gctgatgatgcagatgcacgtgagaaggatgcattggcacctatcccaggccggctggtt
tctgagtggcaaataaagctggcacaccgaattagtcccttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342018
Entry
4342018           CDS       T01015                                 
Name
(RefSeq) probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 isoform X1
  KO
K15889  prenylcysteine alpha-carboxyl methylesterase [EC:3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00900  Terpenoid backbone biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4342018
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4342018
SSDB
Motif
Pfam: BD-FAE Abhydrolase_3 COesterase Peptidase_S9 Hydrolase_4 Abhydrolase_6 Abhydrolase_2 DLH DUF829 Esterase_PHB
Other DBs
NCBI-GeneID: 4342018
NCBI-ProteinID: XP_015643069
UniProt: Q5Z9I2
LinkDB
Position
6:complement(29955704..29960798)
AA seq 425 aa
MQVELADRAAARPSETGEAPPSSPAAAAAASAAAEDAPLLPGGGGGVRRRVVVSERFRQR
SGSFRREVRRAAEETYLLTRLTLILLRYLGIGYRWIRQFLALCCYTFLLMPGFIQVVYYY
FFSSQVCRSVVYGEQPRNRLDLYIPTDRTGLKPVVAFVTGGAWIIGYKGWGALLGRRLAE
RGILVACIDYRNFPQGTIGDMVEDASQGIAFVCNNIASYGGDPERIYLVGQSAGAHIAAC
TLLHQAIKESGEGDASTWSIAQLKAYFGISGGYNLLNLVDHFHKRGLYRSIFLSIMEGEE
SLQKFSPLVMVKDPAARSAVSLLPRIFLFHGTSDYSIPSAESEAFFDALQQNGAKADLFL
YDGKTHTDLFLQDPLRGGRDKLLEEIVTVIHNDNPDTSAQHLAVPVARRLVPEFMLMLAG
RVSPF
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgcaggtggagctcgctgaccgcgcggcagcccggcccagcgagacgggggaggctccg
ccgtcatctccagccgccgccgccgctgcatcagcagcagcggaggacgcgccgctcttg
ccaggtggaggtgggggtgtgcggcggcgggtggtggtgagcgagcggttccggcagcgc
agcggatccttccggcgggaggtccgccgcgcggccgaggagacctacctactcacgcgc
ctcacgctcatcctcctccgctacctcgggataggctacagatggatcaggcagttccta
gccctctgttgttacaccttcttgctcatgccaggtttcattcaagttgtatattattat
ttcttctcgagccaagtttgtagaagtgttgtatatggagaacaaccaagaaacaggctg
gatttatacatacctaccgatagaactgggttgaagccagttgtggcatttgtcacgggt
ggagcttggatcatagggtacaaagggtggggggcccttttgggcaggcgcttggcagag
aggggcatcttagttgcatgcattgattacagaaactttcctcaagggactattggtgac
atggtagaagatgcatctcaagggattgcctttgtctgcaataatatagctagttatgga
ggtgatcctgaaaggatttatcttgttggacaatctgctggtgctcatattgctgcttgt
actctcttacaccaagctattaaagaatctggtgaaggagatgcttccacttggagcatt
gcacagctaaaagcttattttggtatttctggcggctataatcttcttaacttggtcgat
catttccataaacgtggcctgtaccgatcgatctttctcagcataatggaaggcgaggag
tcgttgcaaaaattttctccactggtgatggttaaggacccagctgctaggtctgcagta
tctctattacctcgaatattcctttttcatggaacaagtgactattcaataccatcggct
gagagcgaggctttctttgatgctttacaacagaatggcgctaaagcagatctgttcttg
tatgatggaaagacgcatactgacttgttccttcaggatcctctccggggtggtagggat
aagctgctcgaagagattgttactgtgatacacaatgacaatccagatacatctgcccag
catcttgctgtacctgttgcacgccgccttgttcctgaattcatgcttatgcttgctgga
agagttagtcctttctga

DBGET integrated database retrieval system