KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326580
Entry
4326580           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 2
  KO
K13025  ATP-dependent RNA helicase [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4326580
  09122 Translation
   03013 Nucleocytoplasmic transport
    4326580
   03015 mRNA surveillance pathway
    4326580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4326580
   03041 Spliceosome [BR:osa03041]
    4326580
   03009 Ribosome biogenesis [BR:osa03009]
    4326580
   03012 Translation factors [BR:osa03012]
    4326580
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4326580
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4326580
   mRNA cycle factors
    Stress granule specific factors
     4326580
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4326580
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  90S particles
   Helicases
    4326580
Translation factors [BR:osa03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    4326580
SSDB
Motif
Pfam: DEAD Helicase_C AAA_19 AAA_30 ResIII AAA TniB
Other DBs
NCBI-GeneID: 4326580
NCBI-ProteinID: XP_015621327
UniProt: Q5VNM3
LinkDB
Position
1:25636976..25640503
AA seq 404 aa
MAAATTSRRGPGAMDDENLTFETSPGVEVISSFDQMGIRDDLLRGIYAYGFEKPSAIQQR
AVLPIISGRDVIAQAQSGTGKTSMISLSVCQIVDTAVREVQALILSPTRELAAQTERVML
AIGDFINIQVHACIGGKSIGEDIRKLEHGVHVVSGTPGRVCDMIKRRTLRTRAIKLLILD
EADEMLGRGFKDQIYDVYRYLPPELQVCLISATLPHEILEMTSKFMTDPVRILVKRDELT
LEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTERMRSNNFTVSAM
HGDMPQKERDAIMGEFRSGATRVLITTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGR
SGRFGRKGVAINFVKKEDIRILRDIEQYYSTQIDEMPMNVADLI
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggcggcggccaccacgtcgcggcgcggcccgggcgccatggacgacgagaacctcacc
ttcgagacctccccgggggtcgaggtcatcagcagcttcgaccagatggggatccgcgac
gacctcctccgcggcatctacgcctacggcttcgagaagccctccgccatccagcagcgc
gccgtcctccccatcatcagcggccgcgacgtcatcgcccaggcccagtccgggaccggc
aagacctccatgatctcgctctccgtctgccagatcgtagacaccgccgtccgtgaggtg
caggctttaatactgtcaccaactagagaacttgctgcacaaacagaaagagttatgctg
gctatcggtgacttcatcaatatccaagtgcatgcttgtattggtggcaaaagtattggt
gaggatattagaaagcttgagcacggagtgcatgtggtgtcaggaacacctggcagagtc
tgtgatatgatcaagagaaggaccttgcgtacaagagccattaagctcctaattctggat
gaagctgatgagatgttgggcagaggctttaaggatcagatatatgatgtgtacagatac
ctccctccagaactccaggtttgcttgatctccgcaactctgcctcacgagatcttggaa
atgaccagcaagttcatgactgatccagttcggatccttgtgaagcgtgatgaattgact
ctagagggcatcaaacaattctttgttgctgttgagaaagaagaatggaagtttgacacg
ctttgtgatctttatgatacactgacaatcacccaagctgtcattttctgcaacacaaag
agaaaggttgattggcttacggaaagaatgcgcagcaataacttcacagtatcagctatg
catggcgacatgcctcaaaaggaaagggatgccattatgggtgaattcaggtctggtgca
acccgtgttctaatcacgacagatgtgtgggctcgaggcctcgatgttcagcaggtctct
cttgtcataaattatgatctcccaaataatcgtgaactttacatccatcgcattggtcgc
tctggacgttttggtcgcaagggtgtggccatcaattttgtcaaaaaggaagacatccgt
atcctgagagatatcgagcagtactacagcacgcagattgatgaaatgccaatgaatgtt
gctgatctaatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333273
Entry
4333273           CDS       T01015                                 
Name
(RefSeq) DEAD-box ATP-dependent RNA helicase 34
  KO
K13025  ATP-dependent RNA helicase [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03013  Nucleocytoplasmic transport
osa03015  mRNA surveillance pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4333273
  09122 Translation
   03013 Nucleocytoplasmic transport
    4333273
   03015 mRNA surveillance pathway
    4333273
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4333273
   03041 Spliceosome [BR:osa03041]
    4333273
   03009 Ribosome biogenesis [BR:osa03009]
    4333273
   03012 Translation factors [BR:osa03012]
    4333273
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4333273
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     4333273
   mRNA cycle factors
    Stress granule specific factors
     4333273
Spliceosome [BR:osa03041]
 Complex C
  Other components
   EJC/TREX
    4333273
Ribosome biogenesis [BR:osa03009]
 Eukaryotic type
  90S particles
   Helicases
    4333273
Translation factors [BR:osa03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    4333273
SSDB
Motif
Pfam: DEAD Helicase_C AAA_19 AAA_30 ResIII AAA TniB
Other DBs
NCBI-GeneID: 4333273
NCBI-ProteinID: XP_015633220
UniProt: Q10I26
LinkDB
Position
3:complement(20492418..20496906)
AA seq 404 aa
MAAATTSRRGPGAMDDENLTFETSPGVEVISSFDQMGIREDLLRGIYAYGFEKPSAIQQR
AVLPIISGRDVIAQAQSGTGKTSMISLSVCQIVDTAVREVQALILSPTRELAAQTERVML
AIGDYINIQVHACIGGKSIGEDIRKLEHGVHVVSGTPGRVCDMIKRRTLRTRAIKLLILD
EADEMLGRGFKDQIYDVYRYLPPELQVCLISATLPHEILEMTSKFMTDPVRILVKRDELT
LEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTERMRSNNFTVSAM
HGDMPQKERDAIMGEFRSGATRVLITTDVWARGLDVQQVSLVINYDLPNNRELYIHRIGR
SGRFGRKGVAINFVKKEDIRILRDIEQYYSTQIDEMPMNVADLI
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggcggcggccaccacgtcccggcgcggccccggcgccatggacgacgagaacctcacc
ttcgagacctcccccggggtcgaggtcatcagcagcttcgaccagatggggatccgcgag
gacctcctccgcggcatctacgcctacggcttcgagaagccctccgccatccagcagcgc
gccgtcctccccatcatcagcggccgcgacgtcatcgcccaggcccagtccggaaccggc
aagacctccatgatctcgctctccgtctgccagatcgtcgacaccgccgtccgagaggtt
caggccttgatactctcaccaactagagaacttgctgcacaaacagaaagagttatgctg
gccattggtgattacatcaatatccaagtgcatgcttgtattggtggcaaaagtattggt
gaggatattagaaagcttgagcatggagtgcatgttgtgtcaggaacacctggcagagtc
tgtgatatgatcaagagaaggaccttgcgtacaagagccattaagctcctaattctggat
gaagccgatgagatgttgggcagaggctttaaggatcagatatatgatgtctacagatat
ctacccccagagctccaggtttgcttgatctccgcaactctgccacatgagatcttggaa
atgaccagcaagttcatgactgacccagtccggatccttgtaaagcgtgatgaattgacc
ctagagggcatcaaacaattctttgttgctgttgagaaagaagaatggaagtttgatact
ctttgtgatctttatgatacactgacaatcacccaagctgtcattttctgcaacacgaag
agaaaggttgattggcttacagaaagaatgcgcagcaataacttcacggtatcagctatg
catggtgacatgcctcaaaaggaaagggatgccattatgggtgaattcaggtctggtgca
acccgtgttctaattacgacagatgtgtgggctcgaggcctggatgttcagcaggtctct
cttgtcataaactatgatcttccaaataatcgtgaactttacatccatcgcattggtcgc
tctggacgttttggtcgcaagggtgtggccatcaattttgtcaaaaaggaagacatccgt
atcctgagagatattgagcagtactacagcacacagattgatgaaatgccaatgaatgtt
gctgatctaatttga

DBGET integrated database retrieval system