KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326593
Entry
4326593           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L31
  KO
K02909  large subunit ribosomal protein L31
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326593
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326593
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Large subunit
    4326593
SSDB
Motif
Pfam: Ribosomal_L31
Other DBs
NCBI-GeneID: 4326593
NCBI-ProteinID: XP_015625272
UniProt: Q8RVB1 A0A8J8XN43
LinkDB
Position
1:complement(25350662..25351559)
AA seq 135 aa
MALSLSTSFLPTQAAAAATRTTLRSLVPSQRMRCSMRKKGLHPEIYEDAKVYCNGELVLV
TGGTKPEYTVDVWSGNHPYYVGDTSAMVVMDSQIEKFRKKWGHIKEYWPEDQWREMHPDG
DPEFDPEEEGSAGAS
NT seq 408 nt   +upstreamnt  +downstreamnt
atggcgctctccctctccacctccttcctcccgacccaagccgccgcggcggccacgagg
accaccctccgctccctcgtcccctcccagaggatgcggtgctcgatgcggaagaagggg
ctgcacccggagatctacgaggacgcgaaggtgtactgcaacggggagctggtgctggtg
acggggggaaccaagccggagtacacggtggacgtgtggtcggggaaccacccctactac
gtcggcgacacgtcggcgatggtcgtcatggacagccagatcgagaagttccgcaagaag
tggggccacatcaaggagtactggcccgaggaccagtggagggagatgcaccccgacggc
gacccggagttcgacccggaggaggagggatccgccggcgccagctga

DBGET integrated database retrieval system